| PDBID: | 9nz2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of antibody 22F5 in complex with pre-fusion stabilized LayV-F | | Authors: | May, A.J., Kumar, U., Acharya, P. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qq9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the relaxase domain of RelpLS20, prototype of MobL family of relaxases | | Authors: | Crespo, I., Boer, D.R. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qq8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qqa | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qqb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qq5 | | Status: | HPUB -- hold until publication | | Title: | Mini-bacterioferritin from Candidatus Methanoperedens species BLZ2 in a partially oxidized state | | Authors: | Wissink, M., Wagner, T. | | Deposition date: | 2025-03-31 | | Sequence: | >Entity 1
MSQKIIDALNKDREEELSAIIQYMKHHYEGEGMESPAILEIFKSIAKSEMDHAEKLGERIVYLGGTPTKKPEPIAEGGDLKKMVQDDLAKENHAIEQYKEHIKLAIEEDDPTTRLMLEEILSDEEDHADTWQTLLKVKK
|
|
| PDBID: | 9qqh | | Status: | HPUB -- hold until publication | | Title: | Mini-bacterioferritin from Candidatus Methanoperedens species BLZ2 oxidized then chemically reduced | | Authors: | Wissink, M., Wagner, T. | | Deposition date: | 2025-03-31 | | Sequence: | >Entity 1
MSQKIIDALNKDREEELSAIIQYMKHHYEGEGMESPAILEIFKSIAKSEMDHAEKLGERIVYLGGTPTKKPEPIAEGGDLKKMVQDDLAKENHAIEQYKEHIKLAIEEDDPTTRLMLEEILSDEEDHADTWQTLLKVKK
|
|
| PDBID: | 9qqi | | Status: | HPUB -- hold until publication | | Title: | Mini-bacterioferritin from Candidatus Methanoperedens species BLZ2 untreated control of a redox cycling experiment | | Authors: | Wissink, M., Wagner, T. | | Deposition date: | 2025-03-31 | | Sequence: | >Entity 1
MSQKIIDALNKDREEELSAIIQYMKHHYEGEGMESPAILEIFKSIAKSEMDHAEKLGERIVYLGGTPTKKPEPIAEGGDLKKMVQDDLAKENHAIEQYKEHIKLAIEEDDPTTRLMLEEILSDEEDHADTWQTLLKVKK
|
|
| PDBID: | 9qq3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human carbonic anhydrase VII in complex with a benzenesufonamide derivative containing the duloxetine moiety | | Authors: | D''Ambrosio, K., Di Fiore, A., De Simone, G. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qpz | | Status: | HPUB -- hold until publication | | Title: | KRAS-WT(1-169) - GDP IN COMPLEX WITH compound (R)-1 | | Authors: | Ostermann, N. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qq2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human carbonic anhydrase VII in complex with a benzenesulfonamide derivative containing the duloxetine moiety. | | Authors: | Di Fiore, A., D''Ambrosio, K., De Simone, G. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qq0 | | Status: | HPUB -- hold until publication | | Title: | KRAS-G12D(1-169) - GDP IN covalent COMPLEX WITH compound (3R,4R)-3 | | Authors: | Ostermann, N. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qqc | | Status: | HPUB -- hold until publication | | Title: | Acoustofluidic Sample Delivery System for Serial Crystallography, Thaumatin with acoustic ON | | Authors: | Bjelcic, M., Sellberg, J., Rajendran, K.V., Casadei, C., Viklund, T.E. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qq1 | | Status: | HPUB -- hold until publication | | Title: | KRAS-G12D(1-169) - GDP IN covalent COMPLEX with compound (3S,4R)-8 | | Authors: | Ostermann, N. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qqg | | Status: | HPUB -- hold until publication | | Title: | Acoustofluidic Sample Delivery System for Serial Crystallography, Thaumatin with acoustic OFF | | Authors: | Bjelcic, M., Sellberg, J., Rajendran, K.V., Casadei, C., Viklund, T.E. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9u9w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IphC close conformation | | Authors: | Garg, H., Mahto, J.K., Kumar, P. | | Deposition date: | 2025-03-30 |
|
| PDBID: | 9u9x | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-30 |
|
| PDBID: | 9u9y | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-30 |
|
| PDBID: | 9u9z | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-30 |
|
| PDBID: | 9nyz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-30 |
|
| PDBID: | 9qpx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-30 |
|
| PDBID: | 9u9o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phtE open conformation | | Authors: | Mahto, J.K., Kumar, P. | | Deposition date: | 2025-03-29 |
|
| PDBID: | 9u9p | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phtE close conformation | | Authors: | Mahto, J.K., Kumar, P. | | Deposition date: | 2025-03-29 |
|
| PDBID: | 9u9r | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-29 |
|
| PDBID: | 9u9s | | Status: | HPUB -- hold until publication | | Title: | ARF1(Q71L) bound M4-CTD-docked AP-4 core | | Authors: | Wang, Y.H., Li, W. | | Deposition date: | 2025-03-29 |
|
