Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9bvx
Status:HOLD -- hold until a certain date
Title:SARS-CoV-2 main protease bound to inhibitor YR-C-155
Authors:Liu, W.R., Blankenship, L.R.
Deposition date:2024-05-20
Release date:2025-05-20
PDBID:9fdp
Status:HPUB -- hold until publication
Title:Single particle cryo-EM structure of the AcrB V612W monomer in the O state
Authors:Lazarova, M., Boernsen, C., Frangakis, A., Pos, K.M.
Deposition date:2024-05-17
PDBID:9fdh
Status:HPUB -- hold until publication
Title:Closed Human phosphoglycerate kinase complex with BPG and ADP produced by cross-soaking a TSA crystal
Authors:Cliff, M.J., Waltho, J.P., Bowler, M.W., Baxter, N.J., Bisson, C., Blackburn, G.M.
Deposition date:2024-05-17
PDBID:9fdn
Status:HPUB -- hold until publication
Title:Human phosphoglycerate kinase in complex with ATP and 3PG formed by cross-soaking a TSA crystal
Authors:Cliff, M.J., Waltho, J.P., Bowler, M.W., Baxter, N.J., Bisson, C., Blackburn, G.M.
Deposition date:2024-05-17
PDBID:9fcz
Status:HPUB -- hold until publication
Title:Coxsackievirus A9 bound with compound 17 (CL301)
Authors:Plavec, Z., Butcher, S.J., Mitchell, C., Buckner, C.
Deposition date:2024-05-16
PDBID:8zkj
Status:HPUB -- hold until publication
Title:The crystal structure of apo-LDHC
Authors:Wu, C.Y., Wang, H.L.
Deposition date:2024-05-16
PDBID:9bu7
Status:HPUB -- hold until publication
Title:Cryo-EM Structure of AAV2 Rep68 bound to integration site AAVS1: Insights into the mechanism of DNA melting.
Authors:Escalante, C.R.
Deposition date:2024-05-16
Sequence:

>Entity 1


GPPGFYEIVIKVPSDLDGHLPGISDSFVNWVAEKEWELPPDSDMDLNLIEQAPLTVAEKLQRDFLTEWRRVSKAPEALFFVQFEKGESYFHMHVLVETTGVKSMVLGRFLSQIREKLIQRIYRGIEPTLPNWFAVTKTRNGAGGGNKVVDESYIPNYLLPKTQPELQWAWTNMEQYLSACLNLTERKRLVAQHLTHVSQTQEQNKENQNPNSDAPVIRSKTSARYMELVGWLVDKGITSEKQWIQEDQASYISFNAASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMCAVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYVKKGG

>Entity 2


(DG)(DT)(DT)(DG)(DG)(DG)(DG)(DC)(DT)(DC)(DG)(DG)(DC)(DG)(DC)(DT)(DC)(DG)(DC)(DT)(DC)

>Entity 3


(DG)(DA)(DG)(DC)(DG)(DA)(DG)(DC)(DG)(DC)(DC)(DG)(DA)(DG)(DC)(DC)(DC)(DC)(DA)(DA)(DC)
PDBID:9bu9
Status:HPUB -- hold until publication
Title:Mixed-valent (2/3) dimanganese SfbO
Authors:Liu, C., Rittle, J.
Deposition date:2024-05-16
PDBID:9bua
Status:HPUB -- hold until publication
Title:SfbO reconstituted with Mn(II) anaerobically
Authors:Liu, C., Rittle, J.
Deposition date:2024-05-16
PDBID:9fc6
Status:HPUB -- hold until publication
Title:HEN EGG-WHITE Lysozyme incubated at 87% relative humidity
Authors:Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A.
Deposition date:2024-05-15
PDBID:9fc7
Status:HPUB -- hold until publication
Title:HEN EGG-WHITE Lysozyme incubated at 99% relative humidity
Authors:Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A.
Deposition date:2024-05-15
PDBID:9fc8
Status:HPUB -- hold until publication
Title:HEN EGG-WHITE Lysozyme incubated at 60% relative humidity
Authors:Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A.
Deposition date:2024-05-15
PDBID:9btk
Status:HOLD -- hold until a certain date
Title:Structure of the SARS-CoV-2 main protease in complex with inhibitor YR-C-108T
Authors:Blankenship, L.R., Liu, W.R.
Deposition date:2024-05-15
Release date:2025-05-15
PDBID:9btr
Status:HOLD -- hold until a certain date
Title:Structure of the SARS-CoV-2 main protease in complex with inhibitor YR-C-163
Authors:Blankenship, L.R., Liu, W.R.
Deposition date:2024-05-15
Release date:2025-05-15
PDBID:9fbk
Status:HPUB -- hold until publication
Title:Diheme cytochrome c Kustd1711 from Kuenenia stuttgartiensis, without glycerol cryoprotectant
Authors:Hauser, D., Barends, T.R.M.
Deposition date:2024-05-14
PDBID:9fbt
Status:HPUB -- hold until publication
Title:Structure of KPC-2 complexed with benzoxaborole AK-431
Authors:Beer, M., Tooke, C.L., Hinchliffe, P., Spencer, J.
Deposition date:2024-05-14
PDBID:8ziu
Status:HPUB -- hold until publication
Title:Mouse MYH6 R404Q left ventricle actin and myosin complex
Authors:Li, D.N., Zhao, Q.Y., Liu, C.
Deposition date:2024-05-14
PDBID:8zj1
Status:HPUB -- hold until publication
Title:Human left ventricle F-actin
Authors:Li, D.N., Zhao, Q.Y., Liu, C.
Deposition date:2024-05-14
PDBID:8zix
Status:HPUB -- hold until publication
Title:RAT skeletal muscle F-actin
Authors:Li, D.N., Zhao, Q.Y., Liu, C.
Deposition date:2024-05-14
PDBID:8zip
Status:HPUB -- hold until publication
Title:Mouse left ventricle actin and myosin complex
Authors:Li, D.N., Zhao, Q.Y., Liu, C.
Deposition date:2024-05-14
PDBID:8zi9
Status:HPUB -- hold until publication
Title:Human left ventricle actin and myosin complex
Authors:Li, D.N., Zhao, Q.Y., Liu, C.
Deposition date:2024-05-13
PDBID:9bsg
Status:HOLD -- hold until a certain date
Title:Structure of the SARS-CoV-2 main protease in complex with inhibitor VB-C-20
Authors:Blankenship, L.R., Liu, W.R.
Deposition date:2024-05-13
Release date:2025-05-13
PDBID:9bsp
Status:HOLD -- hold until a certain date
Title:Structure of the SARS-CoV-2 main protease in complex with inhibitor VB-C-68
Authors:Blankenship, L.R., Liu, W.R.
Deposition date:2024-05-13
Release date:2025-05-13
PDBID:9bsq
Status:HOLD -- hold until a certain date
Title:Structure of the SARS-CoV-2 main protease in complex with inhibitor VB-C-70
Authors:Blankenship, L.R., Liu, W.R.
Deposition date:2024-05-13
Release date:2025-05-13
PDBID:8zi1
Status:HPUB -- hold until publication
Title:Cryo-EM reveals transition states of the Acinetobacter baumannii F1-ATPase rotary subunits gamma and epsilon and novel compound targets - Conformation 2
Authors:Le, K.C.M., Wong, C.F., Gruber, G.
Deposition date:2024-05-12

222624

數據於2024-07-17公開中

PDB statisticsPDBj update infoContact PDBjnumon