| PDBID: | 9w7n | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Vaborbactam in complex with SME-1 class A Carbapenemase | | Authors: | Dhankhar, K., Hazra, S. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 9w7o | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Taniborbactam in complex with SME-1 class A Carbapenemase | | Authors: | Dhankhar, K., Hazra, S. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 9w7d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | cryo-EM structure of PSII PsbA3-S264V in complex with DCMU from Thermosynechococcus vestitus BP-1 | | Authors: | Fan, S.B., Jiang, H.W., Kato, K., Tsai, P.-C., Jia, A.Q., Nakajima, Y., Sugiura, M., Shen, J.R. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 9w7p | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Ledaborbactam in complex with SME-1 class A Carbapenemase | | Authors: | Dhankhar, K., Hazra, S. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 9px8 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed Orb2 amyloid (LVLVF, polymorph 1) | | Authors: | Singh, R., Kaili, L., Si, K., Joachimiak, L. | | Deposition date: | 2025-08-05 | | Sequence: | >Entity 1
QLHQQQHQQQHLQHVQHLQQVQFHQHQQQLS
|
|
| PDBID: | 9w6s | | Status: | HPUB -- hold until publication | | Title: | hCA450-21.1 Fab and GD2 complex | | Authors: | Deyong, S., Muding, R. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9w72 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 1) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s7m | | Status: | HPUB -- hold until publication | | Title: | HIV-1 capsid (M-group) - native in complex with JW3-093 | | Authors: | Govasli, M.A.L., Pinotsis, N., Towers, G., Selwood, D., Jacques, D.A. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9w6j | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 1, top NCP) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9w6k | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 1&2, bottom NCP) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9w6d | | Status: | HPUB -- hold until publication | | Title: | EricAPN in complex with RU15-1 RBD | | Authors: | Zhu, Q. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9pvx | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with dA at +1 site, 8-oxo-GTP bound in E-site. | | Authors: | Hou, P., Oh, J., Wang, D. | | Deposition date: | 2025-08-03 |
|
| PDBID: | 9pvo | | Status: | HPUB -- hold until publication | | Title: | Novel site 1 interaction of the IR/Ins-AC-S2 complex | | Authors: | Vogel, A., Blakely, A., Hill, C.P. | | Deposition date: | 2025-08-03 |
|
| PDBID: | 9pvu | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with dC at +1 site, 8-oxo-GMP added. | | Authors: | Hou, P., Oh, J., Wang, D. | | Deposition date: | 2025-08-03 |
|
| PDBID: | 9pvv | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with dC at +1 site, 8-oxo-GTP bound in A-site. | | Authors: | Hou, P., Oh, J., Wang, D. | | Deposition date: | 2025-08-03 |
|
| PDBID: | 9pvw | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with dA at +1 site, 8-oxo-GMP added in Syn-conformation | | Authors: | Hou, P., Oh, J., Wang, D. | | Deposition date: | 2025-08-03 |
|
| PDBID: | 9pvn | | Status: | HPUB -- hold until publication | | Title: | Human malic enzyme 3 complex with inhibitor NPD-389 at 1.82 Angstrom. | | Authors: | Krinkel, B.A., Yosaatmadja, Y., Squire, C.J., Loomes, K.M. | | Deposition date: | 2025-08-02 |
|
| PDBID: | 9s6j | | Status: | HPUB -- hold until publication | | Title: | HIV-1 capsid (M-group) - CPSF6 | | Authors: | Govasli, M.A.L., Pinotsis, N., Towers, G., Selwood, D., Jacques, D.A. | | Deposition date: | 2025-08-01 |
|
| PDBID: | 9s6v | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HIV-1 capsid (M-group) - native in complex with JW3-094 | | Authors: | Govasli, M.A.L., Pinotsis, N., Towers, G., Selwood, D., Jacques, D.A. | | Deposition date: | 2025-08-01 |
|
| PDBID: | 9w5b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | cryo-EM structure of PSII D1-S264V from Thermosynechococcus vestitus BP-1 | | Authors: | Fan, S.B., Jiang, H.W., Kato, K., Tsai, P.-C., Jia, A.Q., Nakajima, Y., Sugiura, M., Shen, J.-R. | | Deposition date: | 2025-08-01 |
|
| PDBID: | 9s65 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of human Programmed cell death 1 ligand 1 (PD-L1) with a covalent inhibitor | | Authors: | Wilk, P., Kitel, R. | | Deposition date: | 2025-07-31 |
|
| PDBID: | 9pur | | Status: | HPUB -- hold until publication | | Title: | Human respirovirus 1 hemagglutinin-neuraminidase dimer in complex with VHH A2R3-60 | | Authors: | Zhou, L., McLellan, J.S. | | Deposition date: | 2025-07-31 |
|
| PDBID: | 9s64 | | Status: | HPUB -- hold until publication | | Title: | Human TEAD1 in complex with 2-(4-chloro-3-{3-methyl-5-[4-(trifluoromethyl)phenoxy]phenyl}-1H-pyrrolo[3,2-c]pyridin-1-yl)ethan-1-ol | | Authors: | Musil, D., Freire, F. | | Deposition date: | 2025-07-30 |
|
| PDBID: | 9w43 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the complex of human PD-1 and a PD-1-directed antibody | | Authors: | Jiang, W.B., Xu, J.L. | | Deposition date: | 2025-07-30 | | Release date: | 2026-07-30 |
|
| PDBID: | 9s5q | | Status: | HPUB -- hold until publication | | Title: | Time-resolved SFX series of the DtpAa Y389F variant mixed with hydrogen peroxide -time 1 s | | Authors: | Williams, L.J., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2025-07-29 | | Sequence: | >Entity 1
DPAGADAGSAVPFHGAHQAGIATPVQDRLHFAAFDVTTEDRAAFVALLKEWTAAARRLTAGHAVGEGAYGGLPEAPPDDTGEALGLKPSRLTLTIGFGPSLFTRFGLADLRPEALADLPKFPGDNLDRARSGGDLCVQACADDPQVAVHAIRNLARIGFGKVVVRWSQLGFGKTSSTTPDKQTPRNLLGFKDGTRNIAGTEKDRLDRFVWAAEKDGTPWMTGGSYLVARRIRMHIETWDRASLQEQEDVFGRDKGEGAPVGKAKERDEPFLKAMKPDAHVRLAHPDSNGGATLLRRGYSFTDGTDGLGRLDAGLFFLAYQRDIRTGFVPVQRNLATDALNEFIQHVGSAVFAVPPGVRDADDWWGSTLFGKEA
|
|
