| PDBID: | 7i8b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 54b bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 7i8c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 54b bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 7i8d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 61a bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 7i8e | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 58d bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 7i8f | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 58e bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 7i8g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 58f bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 7i8h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 58b bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 7i8i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 61b bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 7i8j | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 61g bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 9nph | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of recombinant Can f 1 in complex with human IgE mAb 1J11 Fab | | Authors: | Khatri, K., Ball, A., Smith, S.A., Champan, M.D., Pomes, A., Chruszcz, M. | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9npi | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of recombinant Can f 1 in complex with human IgE 12F3 Fab | | Authors: | Khatri, K., Ball, A., Smith, S.A., Champan, M.D., Pomes, A., Chruszcz, M. | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9npg | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of recombinant Can f 1-C100S in complex with human IgE mAb 12F3 Fab | | Authors: | Khatri, K., Ball, A., Smith, S.A., Champan, M.D., Pomes, A., Chruszcz, M. | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9qd6 | | Status: | HOLD -- hold until a certain date | | Title: | High resolution structure of the artificially maturated [FeFe]-hydrogenase from Nitratidesulfovibrio vulgaris str. Hildenborough | | Authors: | Bikbaev, K., Harand, T., Scheuenstuhl, L., Span, I. | | Deposition date: | 2025-03-06 | | Release date: | 2025-04-03 |
|
| PDBID: | 9qdc | | Status: | HOLD -- hold until a certain date | | Title: | Nitratidesulfovibrio vulgaris [FeFe]-hydrogenase crystallized in the sodium formate buffer at pH 4.6 | | Authors: | Bikbaev, K., Span, I. | | Deposition date: | 2025-03-06 | | Release date: | 2025-04-03 |
|
| PDBID: | 9qdd | | Status: | HOLD -- hold until a certain date | | Title: | Nitratidesulfovibrio vulgaris [FeFe]-hydrogenase crystallized in the sodium acetate buffer at pH 5.3 | | Authors: | Bikbaev, K., Span, I. | | Deposition date: | 2025-03-06 | | Release date: | 2025-04-03 |
|
| PDBID: | 9qdg | | Status: | HOLD -- hold until a certain date | | Title: | Nitratidesulfovibrio vulgaris [FeFe] hydrogenase crystallized in the sodium propionate buffer at pH 5.0 | | Authors: | Bikbaev, K., Span, I. | | Deposition date: | 2025-03-06 | | Release date: | 2026-03-06 |
|
| PDBID: | 9qdk | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma brucei PTR1 in complex with fragment L330 and compound F46 | | Authors: | Landi, G., Mangani, S., Pozzi, C. | | Deposition date: | 2025-03-06 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 9m54 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of neuropeptide FF receptor 2 complex with NPVF | | Authors: | Pan, B.X., Jiang, Y., Li, X.Z. | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9m2f | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of neuropeptide FF receptor 1 complex with NPFF | | Authors: | Pan, B.X., Jiang, Y., Li, X.Z. | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9m2a | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of the trypanosome alternative oxidase complexed with a trypanocidal phosphonium derivative (compound1) | | Authors: | Ebiloma, G.U., Balogun, E.O., Dardonville, C., De Koning, H.P., Shiba, T. | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9m1o | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structures of NPFFR2 complex with neuropeptide FF | | Authors: | Pan, B.X., Li, X.Z., Jiang, Y. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9m0r | | Status: | HPUB -- hold until publication | | Title: | Structure of neuropeptide FF receptor 1 complex with NPVF | | Authors: | Pan, B.X., Jiang, Y., Li, X.Z. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9lym | | Status: | HPUB -- hold until publication | | Title: | Functional characterization of type III polyketide synthases involved in tropane alkaloid biosynthesis in Brassicaceae | | Authors: | Yan, Y.J., Huang, S.X. | | Deposition date: | 2025-02-20 |
|
| PDBID: | 9iga | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Beta-hairpin macrocyclic peptide in complex with STAT1 | | Authors: | Pantelejevs, T. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ife | | Status: | HPUB -- hold until publication | | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z943693514 | | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | | Deposition date: | 2025-02-18 |
|
