Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9nyd
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the glycosyltransferase GtrB in the pre-catalysis and product-bound state
Authors:Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F.
Deposition date:2025-03-27
PDBID:9nyf
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the glycosyltransferase GtrB (tetramer volume)
Authors:Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F.
Deposition date:2025-03-27
PDBID:9nye
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the glycosyltransferase GtrB in the apo state (octamer volume)
Authors:Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F.
Deposition date:2025-03-27
PDBID:9nyk
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the glycosyltransferase GtrB in the pre-intermediate state
Authors:Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F.
Deposition date:2025-03-27
PDBID:9nyc
Status:HPUB -- hold until publication
Title:Cryo-EM structure of the glycosyltransferase GtrB in the substrate-bound state
Authors:Morgan, R.T., Motta, S., Gil-Iturbe, E., Bhattacharjee, B., di Muccio, G., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F.
Deposition date:2025-03-27
PDBID:9nym
Status:HPUB -- hold until publication
Title:Crystal structure of an MKP5 allosteric loop mutant, N448A
Authors:Manjula, R., Bennett, A.M., Lolis, E.
Deposition date:2025-03-27
PDBID:9qpk
Status:HPUB -- hold until publication
Title:E.coli TalB mutant E96Q, F178Y, R300E
Authors:Soderholm, A., Roos, A., Widersten, M.
Deposition date:2025-03-27
PDBID:9qoh
Status:HPUB -- hold until publication
Title:Mouse Ribosome POST translocation state
Authors:Santo, P.E., Astier, A., Plisson-Chastang, C.
Deposition date:2025-03-26
PDBID:9qog
Status:HPUB -- hold until publication
Title:Crystal structure of Affitin C10 in complex with a a double-helical aromatic oligoamide foldamer
Authors:Sigl, J.C., Sachs, J., Merlet, E., Ferrand, Y., Huc, I.
Deposition date:2025-03-26
PDBID:9qoq
Status:HPUB -- hold until publication
Title:Leishmania donovani ISP2 in complex with bovine trypsin
Authors:Freitag-Pohl, S., Pohl, E.
Deposition date:2025-03-26
PDBID:9u77
Status:HPUB -- hold until publication
Title:Crystal structure of Glycogen branching enzyme (VvGBE) from Vibrio vulnificus MO6-24/O
Authors:An, Y., Lee, S.J., Park, J.T., Woo, E.J.
Deposition date:2025-03-24
Sequence:

>Entity 1


MRIVFTTLAVWRGKKGLKKLVKSKVNQMFEKLSQAACSEPFAFLGPFIDPTQGALRVWMPGATGVALVLEGQPRIALEREKESAFILKADLNLHLTHYQLAIDWNGVEQLIDDPYQYHGIYAEYDDLHTPKTMYQHMGSQFMTLERDGKSISGIRFLVYAPHATAVSLVGCFNDWDGRRHPMQRLDYGIWGLFIPGLTEGVSYKFEMKGPKGEGLPHKADPWGFYAEQYPSFASVTYDHARYQWQDAQWQTRPVTEKRKEALSFYELHAGSWKRNEQGEFLNYRELAAELVPYLVDMGYTHVELMPVSEHPFYGSWGYQPVGLFAPTSRYGSPDDFKFFVDACHQAGIGVVLDWVPAHFPSDDHGLANFDGTPLFHDPDPRRGWHQDWNSFIYDLGREQVRRFLVSNALYWFEQFHIDGIRVDAVASMLYLDYSRSHGQWIPNMDGGNENYDAIATLKWMNEEVYKYFPNAMTIAEESTAFPGVSAPTFMGGLGFGFKWNMGWMHDSLSYIKEEPVHRKYHHNTLTFPLVYAHSENYVLSLSHDEVVYGKGSIHNKMPGDEWQQTANLRAYFGYMYGQPGKKLNFMGAEIGQTAEWNHDDQLQWFLLDFPRHQGVQALTRDLNHLYRNEAALHDQDCIPAGFEWRLQDAAEQSIIAHERISEAGERILVVSNFTPVPRDEFRLGVPNKGRYQLLLNTDDSKYAGSGYEVVVDAKSEAVVSEDLAQSIVLRLPPLSTLFYKLV
PDBID:9nwt
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of DDB1dB:CRBN:mezigdomide:SALL4(392-449;G416A)
Authors:Park, J., Hunkeler, M., Roy Burman, S.S., Fischer, E.S.
Deposition date:2025-03-24
PDBID:9u5v
Status:HPUB -- hold until publication
Title:Structure of Chloroflexus aggregans flavin based fluorescent protein (CagFbFP) Q89E variant (complex with LC)
Authors:Nikolaev, A., Markeeva, E., Remeeva, A., Borshchevsky, V., Gushchin, I.
Deposition date:2025-03-22
PDBID:9u5n
Status:HPUB -- hold until publication
Title:Structure of Chloroflexus aggregans flavin based fluorescent protein (CagFbFP) Q89E variant (complex with FMN)
Authors:Nikolaev, A., Markeeva, E., Kovalev, K., Gushchin, I.
Deposition date:2025-03-21
PDBID:9nw2
Status:HPUB -- hold until publication
Title:Crystal structure of NP204 TCR in complex with NP366-H-2Db
Authors:Tan, K., Reinherz, E.L., Mallis, R.J.
Deposition date:2025-03-21
PDBID:9qm7
Status:HPUB -- hold until publication
Title:Crystal structure of S-nitrosylated triose phosphate isomerase from Chlamydomonas reinhardtii
Authors:Fanti, S., Fermani, S., Gabellini, G., Zaffagnini, M., Meloni, M., Peppi, G.M.E.
Deposition date:2025-03-21
Sequence:

>Entity 1


ASSAKFFVGGNWK(SNC)NGSVANVAKLVDELNAGTIPRGVDVVVAPPFIYIDYVMQHLDRDKYQLSAQNAWIGGNGAFTGEVSAEQLTDFGVPWVILGHSERRSLFGESNEVVAKKTSHALAAGLGVIACIGETLEQRNSGSVFKVLDAQMDALVDEVKDWTKVVLAYEPVWAIGTGVVASPEQAQEVHAYLRQYCAKKLGAAVADKLRIIYGGSVSDTNCKDLSKQEDIDGFLVGGASLKGAAFVTICNAAGPKAKP
PDBID:9nv2
Status:HPUB -- hold until publication
Title:Crystal structure of NP207 TCR in complex with NP366-H-2Db
Authors:Tan, K., Reinherz, E.L., Mallis, R.J.
Deposition date:2025-03-20
PDBID:9nv6
Status:HPUB -- hold until publication
Title:Crystal structure of NP101 TCR in complex with NP366-H-2Db
Authors:Tan, K., Reinherz, E.L., Mallis, R.J.
Deposition date:2025-03-20
PDBID:9nva
Status:HPUB -- hold until publication
Title:Crystal structure of NP105 TCR in complex with NP366-H-2Db
Authors:Tan, K., Reinherz, E.L., Mallis, R.J.
Deposition date:2025-03-20
PDBID:9nve
Status:HPUB -- hold until publication
Title:Crystal structure of NP203 TCR in complex with NP366-H-2Db
Authors:Tan, K., Reinherz, E.L., Mallis, R.J.
Deposition date:2025-03-20
PDBID:9ql0
Status:HOLD -- hold until a certain date
Title:E. coli IspH crystallized in the presence of adenosine hemisulfate
Authors:Bikbaev, K., Dormann, C., Span, I.
Deposition date:2025-03-20
Release date:2026-03-20
PDBID:9nui
Status:AUTH -- processed, waiting for author review and approval
Title:SsoPfMCM:DNA class 1b from merged particles
Authors:Enemark, E.J., Rasouli, S., Myasnikov, A.
Deposition date:2025-03-19
PDBID:9nuj
Status:AUTH -- processed, waiting for author review and approval
Title:SsoPfMCM:DNA class 1c from merged particles
Authors:Enemark, E.J., Rasouli, S., Myasnikov, A.
Deposition date:2025-03-19
PDBID:9nuk
Status:AUTH -- processed, waiting for author review and approval
Title:SsoPfMCM:DNA class 2a from merged particles
Authors:Enemark, E.J., Rasouli, S., Myasnikov, A.
Deposition date:2025-03-19
PDBID:9nul
Status:HPUB -- hold until publication
Title:SsoPfMCM:DNA class 2b from merged particles
Authors:Enemark, E.J., Rasouli, S., Myasnikov, A.
Deposition date:2025-03-19

238582

數據於2025-07-09公開中

PDB statisticsPDBj update infoContact PDBjnumon