| PDBID: | 9ce0 | | Status: | HPUB -- hold until publication | | Title: | DosP Apo Bent form | | Authors: | Kumar, P., Kober, D.L. | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9ftl | | Status: | HPUB -- hold until publication | | Title: | Asgard ESCRT-IIIB filament structure | | Authors: | Chaaban, S., Souza, D.P., Baum, B. | | Deposition date: | 2024-06-24 |
|
| PDBID: | 9ftm | | Status: | HPUB -- hold until publication | | Title: | Asgard ESCRT-IIIB membrane-bound protofilament structure | | Authors: | Chaaban, S., Souza, D.P., Baum, B. | | Deposition date: | 2024-06-24 |
|
| PDBID: | 9fta | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of d(GGGGTTTTGGGG) with Zn and K | | Authors: | Sbirkova-Dimitrova, H.I., Shivachev, B.L. | | Deposition date: | 2024-06-24 | | Release date: | 2024-12-24 |
|
| PDBID: | 9cd9 | | Status: | HPUB -- hold until publication | | Title: | Structure of type II-2 alpha-synuclein filament from multiple system atrophy | | Authors: | Yan, N.L., Candido, F., Tse, E., Melo, A.A., Southworth, D.R., Merz, G.E. | | Deposition date: | 2024-06-24 |
|
| PDBID: | 9cda | | Status: | HPUB -- hold until publication | | Title: | Structure of type I-2 alpha-synuclein filament from multiple system atrophy | | Authors: | Yan, N.L., Candido, F., Tse, E., Melo, A.A., Southworth, D.R., Merz, G.E. | | Deposition date: | 2024-06-24 |
|
| PDBID: | 9cdb | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of CRISPR associated effector, CARF-Adenosine deaminase 1, Cad1, in cA6 (partial density) bound form with ATP (partial density). | | Authors: | Majumder, P., Patel, D.J. | | Deposition date: | 2024-06-24 |
|
| PDBID: | 9fsf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to Ss-MAP leaderless mRNA with h44 in up position | | Authors: | Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E. | | Deposition date: | 2024-06-21 |
|
| PDBID: | 9cch | | Status: | HPUB -- hold until publication | | Title: | Solution structure of the Bsu Anti-TRAP trimer | | Authors: | Foster, M.P., McElroy, C.A., Ihms, E.C., Kumar Yadav, D. | | Deposition date: | 2024-06-21 |
|
| PDBID: | 9cci | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Dissecting human monoclonal antibody responses from mRNA and protein-based booster vaccinations against XBB1.5 SARS-CoV-2 | | Authors: | Bajic, G., Jaiswal, D. | | Deposition date: | 2024-06-21 |
|
| PDBID: | 9fs8 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to Ss-aEF1A-like mRNA | | Authors: | Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E. | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9fs6 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to Ss-aIF2beta leaderless mRNA with h44 in up position | | Authors: | Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E. | | Deposition date: | 2024-06-20 |
|
| PDBID: | 9frl | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to SD mRNA with h44 in up position | | Authors: | Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9frm | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of glycogen phosphorylase with an indole derivative | | Authors: | Koulas, S.M., Leonidas, D.D. | | Deposition date: | 2024-06-19 | | Sequence: | >Entity 1
MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKI(CSO)GGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYEEYVK(CSO)QERVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEKIP
|
|
| PDBID: | 9frk | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to SD mRNA | | Authors: | Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E. | | Deposition date: | 2024-06-19 |
|
| PDBID: | 9fra | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to Ss-MAP leaderless mRNA | | Authors: | Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E. | | Deposition date: | 2024-06-18 |
|
| PDBID: | 9frc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Architectural insights into spatially distinct corrin and metal binding sites of CobN | | Authors: | Pickersgill, R.W., Brown, D.G., Ladakis, D., Warren, M.J. | | Deposition date: | 2024-06-18 |
|
| PDBID: | 9frd | | Status: | HPUB -- hold until publication | | Title: | Wildtype EGFR bound with Compound 23 | | Authors: | Pagliarini, A.R., Milgram, B.C., Borrelli, D.R., OHearn, E., Huff, M.R., Ladd, B., Brooijmans, N., Henderson, J.A., Hilbert, B.J., Wang, W., Ito, T. | | Deposition date: | 2024-06-18 |
|
| PDBID: | 8zyy | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553 (complex 3) | | Authors: | Sun, D., Li, X., Yuan, Q., Yin, W., Xu, H.E., Tian, C. | | Deposition date: | 2024-06-18 |
|
| PDBID: | 9cb6 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of RT-PhyR (ruthe_02744) | | Authors: | Swingle, D., Isiorho, E.A., Gardner, K.H. | | Deposition date: | 2024-06-18 | | Sequence: | >Entity 1
GEFMPQTFADAVAASLPHLRRYARALTGEQRTGDAIAARTLEGLIADPSVLERDLEPRLMLFRAFHRTWRREGAPVGEADSHLAQRAQSHLARLTPNTREALLLHAIEGFTAQEIGAVMEVPPETAADFIDTALREMAESVAGRVMIIEDEAIIAMDIAAIVREMGHRVTGIARTRFEAVRLAREERPDLILADIQLADNSSGIDAVNEILAEFADLPVIFITAFPERLLTGERPEPAFLITKPYREEQVRSAVSQAMFFASTETLAA
|
|
| PDBID: | 9fqt | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the apo inward-open state | | Authors: | Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 9fqu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the arginine-bound inward-occluded state | | Authors: | Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 9fqv | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the lysine-bound inward-occluded state | | Authors: | Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 9fqw | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the ornithine-bound inward-occluded state | | Authors: | Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 8zyi | | Status: | HPUB -- hold until publication | | Title: | crystal structure of GH57 family amylopullulanase mutant D352N from Aquifex aeolicus in complex wih 6-alpha-D-maltotriosyl-maltotriose | | Authors: | Zhu, Z.M., Wang, W.W., Yu, F. | | Deposition date: | 2024-06-17 |
|
