| PDBID: | 13va | | Status: | PROC -- to be processed | | Title: | Orf9b homodimer in complex with Enamine Z3234951291 | | Authors: | San Felipe, C.J., Fraser, J.S. | | Deposition date: | 2025-10-19 |
|
| PDBID: | 13ut | | Status: | PROC -- to be processed | | Title: | Orf9b homodimer in complex with fragment ZINC000016697555 | | Authors: | San Felipe, C.J., Fraser, J.S. | | Deposition date: | 2025-10-19 |
|
| PDBID: | 13ul | | Status: | PROC -- to be processed | | Title: | Orf9b homodimer in complex with fragment ZINC000000123600 | | Authors: | San Felipe, C.J., Fraser, J.S. | | Deposition date: | 2025-10-19 |
|
| PDBID: | 9x87 | | Status: | HPUB -- hold until publication | | Title: | TGFbetaR2(-1) specific TCR1414_1 | | Authors: | Shi, J.L., Wu, D.C. | | Deposition date: | 2025-10-19 |
|
| PDBID: | 9x81 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the C-terminal of an alpha-amylase family glycosyl hydrolase from Vibrio parahaemolyticus | | Authors: | Cheng, Q., Li, B. | | Deposition date: | 2025-10-18 |
|
| PDBID: | 9x85 | | Status: | HPUB -- hold until publication | | Title: | Complex of HLA-DR4, a class II MHC, with a TGFbetaR2(-1) peptide | | Authors: | Shi, J.L., Wu, D.C. | | Deposition date: | 2025-10-18 |
|
| PDBID: | 9t0o | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Solution structure of Nanofitin C10 in complex with a 12unit aromatic oligoamide foldamer | | Authors: | Largy, E., Morozov, V., Huc, I., Mackereth, C.D. | | Deposition date: | 2025-10-17 |
|
| PDBID: | 9t0h | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to a FDA-approved drug | | Authors: | Miro-Rodriguez, C., Sanchez-Barrena, M.J. | | Deposition date: | 2025-10-17 |
|
| PDBID: | 9yrs | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | E. Coli Glucokinase - K214Q | | Authors: | Andrews, J.R.W., Sakon, J., Fan, C. | | Deposition date: | 2025-10-17 |
|
| PDBID: | 9x7r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The molecular mechanisms of CD8+ T cell responses to restrictive UTP20 antigen | | Authors: | Wang, J., Wu, D.C. | | Deposition date: | 2025-10-17 |
|
| PDBID: | 9x7u | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Complex of HLA-A2, a class I MHC, with a UTP20 peptide | | Authors: | Wang, J., Wu, D.C. | | Deposition date: | 2025-10-17 |
|
| PDBID: | 9t07 | | Status: | HPUB -- hold until publication | | Title: | HUMAN PI3KDELTA IN COMPLEX WITH Roginolisib | | Authors: | Graedler, U., Augustin, M., Goesser, C., Kiefersauer, R. | | Deposition date: | 2025-10-16 | | Sequence: | >Entity 1 MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFHMLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLLIGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSSSEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSVALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMRQEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGGSVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ
>Entity 2 YQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNETEIQRIMHNYEKLKSRISEIVDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLG
|
|
| PDBID: | 9t05 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray structure of the adduct formed by dirhodium tetraacetate with a C-phycocyanin | | Authors: | Merlino, A., Ferraro, G. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9t0c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Atg2-Atg18 complex from yeast | | Authors: | Chumpen Ramirez, S., Shvarev, D., Vargas Duarte, P., Milach, J., Lang, E., Kuchenbuch, S., Reggiori, F., Moeller, A., Ungermann, C. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9t08 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of wild-type c-MET bound by sitravatinib. | | Authors: | Collie, G.W. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9t0b | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of D1228V c-MET bound by sitravatinib. | | Authors: | Collie, G.W. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9t0d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of wild-type c-MET bound by glesatinib | | Authors: | Collie, G.W. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yr7 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human beta-cardiac myosin bound to mavacamten in the interacting-heads motif and S2-FH undocked state | | Authors: | Somavarapu, A.K., Ge, J., Yengo, C.M., Craig, R., Padron, R. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yrg | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of human beta-cardiac myosin in the interacting-heads motif and S2-FH undocked state | | Authors: | Somavarapu, A.K., Ge, J., Yengo, C.M., Craig, R., Padron, R. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yrb | | Status: | HPUB -- hold until publication | | Title: | Factor XIa in complex with Fab fragment of REGN7508-Cat | | Authors: | Saotome, K., Franklin, M.C. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9x7g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PDCoV 3CL protease (3CLpro) in complex with compound 3 | | Authors: | Nie, T.Q., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yq9 | | Status: | HPUB -- hold until publication | | Title: | Clostridium leptum Carboxyaminopropylagmatine Dehydrogenase Apo | | Authors: | Ostlund, J.C., McFarlane, J.S. | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9sz5 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of bacteriophage T5 L-shaped tail fiber : fiber domain | | Authors: | d''Acapito, A., Linares, R., Breyton, C. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9szj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Y1230H c-MET bound by capmatinib. | | Authors: | Collie, G.W., Russell, I.C. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9ypf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | S. aureus YhaM D193A hexamer, 3 NTDs, hairpin RNA substrate | | Authors: | Mattingly, J.M., Tanquary, J.R., Dunham, C.M. | | Deposition date: | 2025-10-14 |
|