| PDBID: | 9wfz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of PSII PsbA3-S264V from Thermosynechococcus vestitus BP-1 (local refinement) | | Authors: | Fan, S.B., Nakajima, Y., Shen, J.R. | | Deposition date: | 2025-08-22 |
|
| PDBID: | 9q5h | | Status: | HPUB -- hold until publication | | Title: | FNAIT Fab B2G1 CONFORMATION 1 | | Authors: | Zhang, H., Zhu, J.Q. | | Deposition date: | 2025-08-20 | | Sequence: | >Entity 1 QVQLVQSGAEVKRPGAAVKVSCKASGYRFTGHYMHWVRQAPGQGLEWMGWINPNSGGTSYAQKFQGRVTMTRDTSISTAYMEMTRLRYDDTAVYYCAAGGLGGYYYYAMNIWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV
>Entity 2 QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTWVFGGGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
|
|
| PDBID: | 9q5d | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of WT HIV-1 Protease (NL4-3) with Inhibitor J02-37 | | Authors: | Shaqra, A.M., Kaur, J., Schiffer, C.A. | | Deposition date: | 2025-08-20 |
|
| PDBID: | 9wev | | Status: | HPUB -- hold until publication | | Title: | Structure of human C5a anaphylatoxin chemotactic receptor 1 bound to human C5a anaphylatoxin (R74Y) | | Authors: | Tiwari, D., Yadav, M.K., Ganguly, M., Mishra, S., Dalal, A., Banerjee, R., Shukla, A.K. | | Deposition date: | 2025-08-20 |
|
| PDBID: | 9q3s | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of PGT121 Fab and Rhesus macaque Ab4 Fab in complex with HIV-1 Env trimer BG505 SOSIP.664 | | Authors: | Chandravanshi, M., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-08-19 |
|
| PDBID: | 9q3z | | Status: | HPUB -- hold until publication | | Title: | Structure of ClpC1 N-terminal Domain complexed with P-Arginine bound to site 1 | | Authors: | Abad-Zapatero, C., Ratia, K.M. | | Deposition date: | 2025-08-19 | | Sequence: | >Entity 1 MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYKLAAALEHHHHHH
|
|
| PDBID: | 9sf5 | | Status: | AUCO -- author corrections pending review | | Title: | KP.3 SARS-CoV2 with fab JN-1.6 local refinement | | Authors: | Duyvesteyn, H.M.E., Ren, J., Stuart, D.I. | | Deposition date: | 2025-08-19 |
|
| PDBID: | 9sf7 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | SARS-CoV2 KP.3 with fab JN.1-9 local refinement | | Authors: | Duyvesteyn, H.M.E., Ren, J. | | Deposition date: | 2025-08-19 |
|
| PDBID: | 9seb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of human exonuclease 1 (Exo1) with DNA and compound 20 | | Authors: | Toste Rego, A., Pica, A., Cornaciu, I., Burgdorf, L., Mann, S.E. | | Deposition date: | 2025-08-15 |
|
| PDBID: | 9q1t | | Status: | HPUB -- hold until publication | | Title: | 1.9 Angstrom crystal structure of the tungsten-dependent aldehyde oxidoreductase WOR83 from Haloferax volcanii | | Authors: | Lanzilotta, W.N., Schut, G., Adams, M.W.W. | | Deposition date: | 2025-08-14 |
|
| PDBID: | 9q0w | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of HIV-1 BG505DS-SOSIP.664 Env Trimer Bound to DFPH-a.01_10R59P_LC Fab | | Authors: | Pletnev, S., Kwong, P. | | Deposition date: | 2025-08-13 |
|
| PDBID: | 9wb5 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the complex TAX-4 1WT/3EA with 1 cGMP | | Authors: | Zhang, X. | | Deposition date: | 2025-08-13 |
|
| PDBID: | 9wb7 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the complex TAX-4 2WT/2EA with 2 cGMP, conformation 1 | | Authors: | Zhang, X. | | Deposition date: | 2025-08-13 |
|
| PDBID: | 9wbc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the complex TAX-4 3WT/1EA with 3cGMP, Open state, conformation 1 | | Authors: | Zhang, X. | | Deposition date: | 2025-08-13 |
|
| PDBID: | 9q09 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of PGT121 Fab and Rhesus macaque Ab76 Fab in complex with HIV-1 Env trimer BG505 SOSIP.664 | | Authors: | Chandravanshi, M., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-08-12 |
|
| PDBID: | 9pzz | | Status: | HPUB -- hold until publication | | Title: | Genetically encoded fluorescent nanobody H11 with 4-(7-nitro-2,1,3-benzoxadiazolyl)-alanine (NBDO) at the W37 position complexed with Arc-NL | | Authors: | Habel, E., Huber, T. | | Deposition date: | 2025-08-12 |
|
| PDBID: | 9q00 | | Status: | HPUB -- hold until publication | | Title: | Genetically encoded fluorescent nanobody H11 with 4-(7-nitro-2,1,3-benzoselenadiazolyl)-alanine (NBDSe) at the W37 position complexed with Arc-NL | | Authors: | Habel, E., Huber, T. | | Deposition date: | 2025-08-12 |
|
| PDBID: | 9q01 | | Status: | HPUB -- hold until publication | | Title: | NowGFP mutant with non-canonical amino acid 4-(7-nitro-2,1,3-benzoxadiazolyl)-alanine (NBDO) in the chromophore site | | Authors: | Habel, E., Huber, T. | | Deposition date: | 2025-08-12 |
|
| PDBID: | 9q02 | | Status: | HPUB -- hold until publication | | Title: | NowGFP mutant with non-canonical amino acid 4-(7-nitro-2,1,3-benzoselenadiazolyl)-alanine (NBDSe) in the chromophore site | | Authors: | Habel, E., Huber, T. | | Deposition date: | 2025-08-12 |
|
| PDBID: | 9wag | | Status: | HPUB -- hold until publication | | Title: | Yeast-expressed polio type 1 expanded virus-like particles | | Authors: | Hong, Q., Cong, Y. | | Deposition date: | 2025-08-12 |
|
| PDBID: | 9wah | | Status: | HPUB -- hold until publication | | Title: | Yeast-expressed polio type 1 stabilized virus-like particles | | Authors: | Hong, Q., Cong, Y. | | Deposition date: | 2025-08-12 |
|
| PDBID: | 9wai | | Status: | HPUB -- hold until publication | | Title: | 3G10 Fab-poliovirus 1 complex | | Authors: | Hong, Q., Cong, Y. | | Deposition date: | 2025-08-12 |
|
| PDBID: | 9scl | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli Serine Palmitoyltransferase bound to PLP-Serine 1 | | Authors: | Cazzola, D., Pohl, E. | | Deposition date: | 2025-08-11 |
|
| PDBID: | 9sce | | Status: | HPUB -- hold until publication | | Title: | Structure of S. pombe PNUTS (565 - 644) bound to Swd2.2 - crystal form 1 | | Authors: | Au, H.C.A., Balikci, E., Kus, K., Grimes, J.M., Vasiljeva, L. | | Deposition date: | 2025-08-10 |
|
| PDBID: | 9sbl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Yeast RNA polymerase II elongation complex with ATP frame-1 | | Authors: | Yi, G., Li, Q., Zhang, P., Wang, D. | | Deposition date: | 2025-08-08 |
|