Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9qz9
Status:HPUB -- hold until publication
Title:mycobacterial cytochrome bc1:aa3 with inhibitor
Authors:Lamers, M.H., Verma, A.K., Noteborn, W.E.M.
Deposition date:2025-04-22
PDBID:9o9w
Status:HPUB -- hold until publication
Title:Crystal structure of an alpha/beta-hydrolase from Actinoplanes sp. DH11
Authors:Norton-Baker, B., Storment, O., Mathews, I.I., Gauthier, N.P., McGeehan, J.E., Beckham, G.T.
Deposition date:2025-04-18
PDBID:9o9i
Status:HPUB -- hold until publication
Title:Crystal structure of mouse Vps29 bound to DENND4C peptide (re-refinement)
Authors:Chen, K.-E., Collins, B.
Deposition date:2025-04-18
PDBID:9qy5
Status:HPUB -- hold until publication
Title:Crystal structure of non-specific endoxylanase from Acetivibrio clariflavus (AcXyn30B), that belongs to subfamily GH30_12.
Authors:Karampa, P., Dimarogona, M., Pentari, C., Topakas, E.
Deposition date:2025-04-17
PDBID:9qy9
Status:HPUB -- hold until publication
Title:Listeria monocytogenes GT108 family enzyme, native
Authors:Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J.
Deposition date:2025-04-17
PDBID:9o8w
Status:HPUB -- hold until publication
Title:Crystal structure of an MKP5 mutant, Y435F, in complex with an allosteric inhibitor
Authors:Manjula, R., Bennett, A.M., Lolis, E.
Deposition date:2025-04-16
PDBID:9qy4
Status:HPUB -- hold until publication
Title:GT108 family enzyme from Chlamydia abortus in complex with mannose-1-phosphate (M1P)
Authors:Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J.
Deposition date:2025-04-16
PDBID:9qwv
Status:HPUB -- hold until publication
Title:Trypanosoma cruzi enoyl-CoA hydratase
Authors:Brannigan, J.A., Dodson, E.J.
Deposition date:2025-04-15
Sequence:

>Entity 1


MLRKSLFLLNSMDPIVKYAQKGAVVTLTLNRPKQLNALNAELTNALAEKLLKCDADPSVSVLIITGEGRSFVAGADIKAMANQTFVEFYKHNMLRGLDTIAAVRKPIIAAVNGFALGGGCELAMSCDIVVASEKAIFGQPEIKIGTIPGAGGTQRLTRLIGKSKAMEWILTGEQYTAEEAERAGLVSRVVRHEELLPTVSAMAEKIALNSPLAVSLAKDCINKALETTLAQGMAYEQRTFQATFATDDQKEGMAAFVEKRKPNFKNA
PDBID:9qx3
Status:HPUB -- hold until publication
Title:E. coli beta-clamp in complex with designed circular peptide
Authors:Simonsen, S., Zhao, J., Soegaard, K., Olsen, J.G., Otterlei, M., Rogers, J.M., Kragelund, B.B.
Deposition date:2025-04-15
Sequence:

>Entity 1


HHMKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALVQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMRL

>Entity 2


(DPN)VFVNLWYEGFS(CCS)(NH2)
PDBID:9qwt
Status:HPUB -- hold until publication
Title:Mouse Ribosome RPS15 (uS19) P131S rotated-2 PRE state
Authors:Santo, P.E., Astier, A., Plisson-Chastang, C.
Deposition date:2025-04-15
PDBID:9qxm
Status:HPUB -- hold until publication
Title:Nostoc sp. 3335mg GT108 family enzyme complex with DMJ
Authors:Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J.
Deposition date:2025-04-15
PDBID:9qx4
Status:HPUB -- hold until publication
Title:Nostoc sp. 3335mg GT108 family enzyme purified in HEPES, with Bis-Tris propane and phosphate in the active site
Authors:Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J.
Deposition date:2025-04-15
PDBID:9o6n
Status:HPUB -- hold until publication
Title:Structure of Siglec-10
Authors:Medina, E., Ming, Q., Tran, T.H., Luca, V.C.
Deposition date:2025-04-14
PDBID:9o6o
Status:HPUB -- hold until publication
Title:Structure of SigLec-10 in complex with 2,6-Sialyllactose
Authors:Medina, E., Ming, Q., Tran, T.H., Luca, V.C.
Deposition date:2025-04-14
PDBID:9o75
Status:HPUB -- hold until publication
Title:Crystal structure of IgG1 I253M at pH 6.5
Authors:Reddem, E.R., Shapiro, L.
Deposition date:2025-04-14
PDBID:9o70
Status:HPUB -- hold until publication
Title:Motif1-Motif2, two domain left-handed parallel G-quadruplex
Authors:Xing, E.R., Yatsunyk, L.A.
Deposition date:2025-04-14
PDBID:9o78
Status:HPUB -- hold until publication
Title:Crystal structure of IgG1 I253M at pH 7.0
Authors:Reddem, E.R., Shapiro, L.
Deposition date:2025-04-14
PDBID:9o7a
Status:HPUB -- hold until publication
Title:Crystal structure of IgG1 WT FC at pH 7.0
Authors:Reddem, E.R., Shapiro, L.
Deposition date:2025-04-14
PDBID:9qw5
Status:HPUB -- hold until publication
Title:Urate Oxidase from Aspergillus Flavus with its Inhibitor 9-Methyl Uric Acid by continuous serial electron diffraction (SerialED)
Authors:Hofer, G., Wang, L., Pacoste, L., Hager, P., Fonjallaz, A., Scaletti Hutchinson, E., Stenmark, P., Di Palma, M., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X.
Deposition date:2025-04-14
PDBID:9qw6
Status:HPUB -- hold until publication
Title:Urate Oxidase from Aspergillus Flavus with its Substrate Uric Acid by continuous serial electron diffraction (SerialED)
Authors:Hofer, G., Wang, L., Pacoste, L., Hager, P., Fonjallaz, A., Scaletti Hutchinson, E., Stenmark, P., Di Palma, M., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X.
Deposition date:2025-04-14
PDBID:9o6j
Status:HPUB -- hold until publication
Title:Structure of Siglec-10 in complex with 2,3-Sialyllactose
Authors:Medina, E., Ming, Q., Tran, T.H., Luca, V.C.
Deposition date:2025-04-13
PDBID:9qvy
Status:HPUB -- hold until publication
Title:Nostoc sp. 3335mg GT108 family enzyme complex with mannose-1-phosphate (M1P)
Authors:Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J.
Deposition date:2025-04-13
PDBID:9qw0
Status:HPUB -- hold until publication
Title:Nostoc sp. 3335mg GT108 family enzyme D90A mutant complex with octyl-mannotetraose and Bis-Tris
Authors:Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J.
Deposition date:2025-04-13
PDBID:9qw1
Status:HPUB -- hold until publication
Title:Nostoc sp. 3335mg GT108 family enzyme D90A mutant complex with octyl-mannotetraose
Authors:Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J.
Deposition date:2025-04-13
PDBID:9qvw
Status:HPUB -- hold until publication
Title:Nostoc sp. 3335mg GT108 family enzyme native
Authors:Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J.
Deposition date:2025-04-12

238582

數據於2025-07-09公開中

PDB statisticsPDBj update infoContact PDBjnumon