| PDBID: | 9o73 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human DAPK1 Catalytic Subunit Complexed with Compound MW01-30-035SRM | | Authors: | Brunzelle, J.S., Shuvalova, L., Roy, S.M., Watterson, D.M. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qw3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepIII-HepII-HepI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qw2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepII-HepI-PhosI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qw4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic PhosII-HepII-HepI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qwl | | Status: | HPUB -- hold until publication | | Title: | Hemolysin-coregulated-protein-1 (Hcp1) from Bacteroides fragilis strain NCTC9343 | | Authors: | Sauer, U.H., Cisneros, D.A. | | Deposition date: | 2025-04-14 | | Sequence: | >Entity 1
(MSE)AFRATLSFAGKEFDVLDCTYSLKRDVDSKGRPSSNIYGGQIRLHVESTDDTSILEN(MSE)TNQFKPHSGSIVFKKGDEEAK(MSE)KELTWENGYITEFTENIDIVGSQP(MSE)TITFVVSAQVIKIGGAQFEQNWPKASGGGHHHHHH
|
|
| PDBID: | 9ugs | | Status: | HOLD -- hold until a certain date | | Title: | Butanol Dehydrogenase | | Authors: | Bai, X., Meng, D., Xu, Y.B., Nam, K.H. | | Deposition date: | 2025-04-13 | | Release date: | 2025-10-13 | | Sequence: | >Entity 1
MDNFNYKNDTKIIFGKDNYSEIGKNIKIFSKKTPKILLHYEADGELIKKLGIYEKVISSLKEFDIEFIELGGVVPNPRLSLVYEGIKICKEENITFILAVGGASVIDSAKAISLGAVDNGDVWDFFTAKRIPQDTLGIGVVLTIPGAGSEMSESSIITDENKKQKAVCDTEVNFPKFAILNPEVCYTIPDRLMAAGIVDILSHLMERYFTKSIDTALSDSLIEATMKIVIKYGPLLMKDRKNYNYCSQIMWAATMAHNGMIACGRVADWASHRIEHEISGIYDLTHGIGMAIIFPAWMKYTKNIRPQIFEKFFKEVFNTVNIDEGINKLEEFFKSLGINLKLSDYGITEEYFSLMAEKALGNSETLGRFMQLNKQDIINILNLAK
|
|
| PDBID: | 9ugt | | Status: | HOLD -- hold until a certain date | | Title: | Structure of Butanol Dehydrogenase in Complex with ADP and Co | | Authors: | Bai, X., Meng, D., Nam, K.H., Xu, Y.B. | | Deposition date: | 2025-04-13 | | Release date: | 2025-10-13 | | Sequence: | >Entity 1
MDNFNYKNDTKIIFGKDNYSEIGKNIKIFSKKTPKILLHYEADGELIKKLGIYEKVISSLKEFDIEFIELGGVVPNPRLSLVYEGIKICKEENITFILAVGGASVIDSAKAISLGAVDNGDVWDFFTAKRIPQDTLGIGVVLTIPGAGSEMSESSIITDENKKQKAVCDTEVNFPKFAILNPEVCYTIPDRLMAAGIVDILSHLMERYFTKSIDTALSDSLIEATMKIVIKYGPLLMKDRKNYNYCSQIMWAATMAHNGMIACGRVADWASHRIEHEISGIYDLTHGIGMAIIFPAWMKYTKNIRPQIFEKFFKEVFNTVNIDEGINKLEEFFKSLGINLKLSDYGITEEYFSLMAEKALGNSETLGRFMQLNKQDIINILNLAK
|
|
| PDBID: | 9qvx | | Status: | HPUB -- hold until publication | | Title: | The targeting of non-fibrillar polyQ via distinct VCP-proteasome coupling | | Authors: | Zhao, D.Y., Mi, C.C. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qvu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepI-(1,5)-KdoI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-12 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9o65 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SHOC2-KRAS-PP1CA (SKP) complex | | Authors: | Finci, L.I., Bonsor, D.A., Simanshu, D.K. | | Deposition date: | 2025-04-11 |
|
| PDBID: | 9ufi | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a PhGs rhamnosyltransferase UGT79G15 from Rehmannia glutinosa in complex with UDP and FSA | | Authors: | Wei, H.L., Liu, W.D., Zhuang, Y.B., Liu, T. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ufd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of BA12-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9uff | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of BA21-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ufl | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of BA22-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ufs | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of BA23-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ufx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of HA11-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ug0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of HA31-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ug1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of HA32-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ufy | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of HA21-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9uf7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a PhGs rhamnosyltransferase UGT79G15 from Rehmannia glutinosa in complex with UDP | | Authors: | Wei, H.L., Liu, W.D., Zhuang, Y.B., Liu, T. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9uf6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of BA1-1-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9o5j | | Status: | HPUB -- hold until publication | | Title: | Human Aconitate Decarboxylase I apo form | | Authors: | Runge, B.R., Monteiro, D.C.F. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9o5n | | Status: | HPUB -- hold until publication | | Title: | Human Aconitate Decarboxylase I bound to citraconate | | Authors: | Runge, B.R., Monteiro, D.C.F. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9quf | | Status: | HPUB -- hold until publication | | Title: | Structure of a fungal Ube2O | | Authors: | Kordic, D., Williams, T.L., Luiza Deszcz, L., Ehrmann, J., Arnese, R., Meinhart, A., Clausen, T. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9qug | | Status: | HPUB -- hold until publication | | Title: | Structure of a UBC-Ubiquitin conjugate | | Authors: | Kordic, D., Williams, T.L., Luiza Deszcz, L., Ehrmann, J., Arnese, R., Meinhart, A., Clausen, T. | | Deposition date: | 2025-04-10 |
|
