PDBID: | 8xu6 | Status: | HOLD -- hold until a certain date | Title: | Study on zinc finger structure and function of tumor suppressor ZMYND11 | Authors: | Bai, X., Chen, Z., Chen, Z. | Deposition date: | 2024-01-12 | Release date: | 2025-01-12 |
|
PDBID: | 8tho | Status: | HPUB -- hold until publication | Title: | Solution structure of the zinc finger repeat domain of BCL11A (ZnF456) | Authors: | Viennet, T., Yin, M., Orkin, S.H., Arthanari, H. | Deposition date: | 2023-07-17 | Sequence: | >Entity 1 SEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE
|
|
PDBID: | 8jpy | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Solution NMR Structure of Zinc-fingers 1 and 1 (fragment 257-320) from human Insulinoma-associated protein 1(INSM1) | Authors: | He, X.L., Yang, Y.H. | Deposition date: | 2023-06-13 |
|
PDBID: | 5uhh | Status: | WDRN -- deposition withdrawn | Title: | Solution NMR structure of human GATA2 N-terminal zinc finger domain | Authors: | Nurmohamed, S.S., Broadhurst, R.W., May, G., Enver, T. | Deposition date: | 2017-01-11 | Release date: | 2018-12-31 |
|
PDBID: | 2kl9 | Status: | WDRN -- deposition withdrawn | Title: | Solution structure of the functional motif zinc finger 5-7 of NRSF/REST | Authors: | Cao, C., Hu, W. | Deposition date: | 2009-06-30 |
|
PDBID: | 2rni | Status: | WDRN -- deposition withdrawn | Title: | Solution structure of the functional motif zinc finger 5-7 of NRSF/REST | Authors: | Cao, C., Hu, W., Yang, Z. | Deposition date: | 2008-01-07 |
|
PDBID: | 2rm7 | Status: | WDRN -- deposition withdrawn | Title: | Drosophila melanogaster CG1218-PA CYR zinc-finger motif | Authors: | Isogai, S., Ariyoshi, M., Tochio, H., Ikegami, T., Ito, Y., Kanno, S., Yasui, A., Shirakawa, M. | Deposition date: | 2007-10-11 |
|
PDBID: | 2e6t | Status: | WDRN -- deposition withdrawn | Title: | Solution structure of the zinc finger domain in LUCA15 | Authors: | Kadirvel, S., He, F., Kusawako, K., Muto, Y., Inoue, M., Kigawa, T., Shirouzu, M., Terada, T., Yokoyama, S., RIKEN Structural Genomics/Proteomics Initiative (RSGI) | Deposition date: | 2006-12-28 |
|