| PDBID: | 9iux | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray crystal structure of human hemoglobin subunit mu C49S/C104S mutant | | Authors: | Lin, Y.W. | | Deposition date: | 2024-07-22 |
|
| PDBID: | 9bch | | Status: | HPUB -- hold until publication | | Title: | Solution structure of the hemoglobin receptor HbpA from Corynebacterium diphtheriae | | Authors: | Mahoney, B.J., Clubb, R.T. | | Deposition date: | 2024-04-09 | | Sequence: | >Entity 1
SEEVKNADLYWGFSGSSHHKYDHNGPKFEKAGKGAELTNIDAASAYAETFKKGVFPNNKREKSDILVFHNGEVKTETNHSSYQINWPGEVTMKLGYGDGLVIKDLNLMLKNGNMGELKATVGENSNITLFDVQEYSVSDNTITVTPKIPPCTTGTWKPWHNDLTSKLGSLKSVFFESYTCNNDDIAKKPLPLTVVLNG
|
|
| PDBID: | 8w54 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of Pyruvic acid Mediated Glycation of Bovine Hemoglobin Covalently Linked with CEL | | Authors: | Saraswathi, N.T., Esackimuthu, P. | | Deposition date: | 2023-08-25 | | Release date: | 2024-08-25 |
|
| PDBID: | 8w55 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of glyoxal Mediated Glycation of Bovine Hemoglobin Covalently Linked with GH1 | | Authors: | Saraswathi, N.T., Esackimuthu, P. | | Deposition date: | 2023-08-25 | | Release date: | 2024-08-25 |
|
