| PDBID: | 9yv3 | | Status: | PROC -- to be processed | | Title: | Crystal Structure of a ternary complex of Saccharomyces cerevisiae Sec14 with a small molecule inhibitor and phosphatidylcholine | | Authors: | Singh, P.K., Green, S.M., Krieger, I., Sacchettini, J., Igumenova, T.I., Bankaitis, V.A. | | Deposition date: | 2025-10-23 | | Release date: | 2026-10-23 |
|
| PDBID: | 9t1y | | Status: | PROC -- to be processed | | Title: | Plasmodium falciparum Aminopeptidase P in complex with hydroxamic-peptide based inhibitor 6e | | Authors: | Gregory, K.S., Acharya, K.R. | | Deposition date: | 2025-10-22 |
|
| PDBID: | 9t1x | | Status: | PROC -- to be processed | | Title: | Plasmodium falciparum Aminopeptidase P in complex with hydroxamic-peptide based inhibitor 6d | | Authors: | Gregory, K.S., Cozier, G.E., Acharya, K.R. | | Deposition date: | 2025-10-22 |
|
| PDBID: | 9t27 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with S1.1 | | Authors: | Millet, O., Rojas, L.A., Scarin, R. | | Deposition date: | 2025-10-22 |
|
| PDBID: | 9yte | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ternary complex of BTK kinase domain and Celebron induced by PS-10 | | Authors: | Marsalek, L., Lin, H., Wang, J. | | Deposition date: | 2025-10-20 |
|
| PDBID: | 9ysl | | Status: | PROC -- to be processed | | Title: | Human DNA polymerase beta mutant E71A crosslinked binary complex | | Authors: | Gaur, A., Suo, Z. | | Deposition date: | 2025-10-19 |
|
| PDBID: | 9yr5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BG505.DS.SOSIP.T332N wild-type HIV-1 Envelope bound to 2 VRC16 human IgG1 fab regions | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9yr8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BG505.DS.SOSIP.T332N wild-type HIV-1 Envelope bound to 1 VRC16 human IgG1 fab region | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9szx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with 3C9 | | Authors: | Scarin, R., Rojas, A.L., Millet, O. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9szm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with 3C10 | | Authors: | Scarin, R., Rojas, A.L., Millet, O. | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9ypf | | Status: | PROC -- to be processed | | Title: | S. aureus YhaM D193A hexamer, 3 NTDs, hairpin RNA substrate | | Authors: | Mattingly, J.M., Tanquary, J.R., Dunham, C.M. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9yo0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM sub-structure of Rhinolophus sp. PRD-0038 trimeric prefusion spike protein with D603G and Q617K mutations and 3 RBDs in the down state | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-13 |
|
| PDBID: | 9yod | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM sub-structure of Rhinolophus sp. PRD-0038 trimeric prefusion spike protein with D603G and Q617K mutations and 1 RBD in the up state | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-13 |
|
| PDBID: | 9yoh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM sub-structure of Rhinolophus sp. PRD-0038 trimeric prefusion spike protein with D603G and Q617K mutations and 2 RBDs in the up state | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-13 |
|
| PDBID: | 9yp5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Rhinolophus sp. PRD-0038 trimeric prefusion spike protein with the Q617K mutation and 3 RBDs in the down state | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-13 |
|
| PDBID: | 9yp7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Rhinolophus sp. PRD-0038 trimeric prefusion spike protein with the D603G mutation | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-13 |
|
| PDBID: | 9ypa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Rhinolophus sp. PRD-0038 trimeric prefusion spike protein with the Q617K mutation and 1 RBD in the up state | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-13 |
|
| PDBID: | 9ym9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of AGO2 primary RISC (pri-RISC) | | Authors: | Zhang, H., Adhav, V.A., Kehling, A.C., Nakanishi, K. | | Deposition date: | 2025-10-09 |
|
| PDBID: | 9yme | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of wild-type Rhinolophus sp. PRD-0038 trimeric prefusion spike protein | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-09 |
|
| PDBID: | 9ymh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM consensus structure of Rhinolophus sp. PRD-0038 trimeric prefusion spike protein with D603G and Q617K mutations | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2025-10-09 |
|
| PDBID: | 9swz | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of MM762(D10A)-sgRNA/DNA ternary complex | | Authors: | Ekundayo, B.E., Ni, D.C., Stahlberg, H. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9sx0 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of eMM762v1-sgRNA/DNA ternary complex | | Authors: | Ekundayo, B.E., Ni, D.C., Stahlberg, H. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9sx4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with HT1.6 | | Authors: | Scarin, R., Rojas, A.L., Millet, O. | | Deposition date: | 2025-10-08 |
|
| PDBID: | 9yk3 | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of D132N Bacillus halodurans RNase H1 in complex with complementary RNA/DNA duplex | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-06 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
>Entity 2
CGACAU
>Entity 3
(DA)(DT)(DG)(DT)(DC)(DG)
|
|
| PDBID: | 9sw1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with A4 | | Authors: | Scarin, R., Rojas, A.L., Millet, O. | | Deposition date: | 2025-10-04 |
|
