PDBID: | 9chu | Status: | PROC -- to be processed | Title: | Cryo-EM structure of calcineurin fused beta2 adrenergic receptor in norepinephrine bound inactive state | Authors: | Jun, X. | Deposition date: | 2024-07-02 |
|
PDBID: | 9chv | Status: | PROC -- to be processed | Title: | cryo-EM structure of calcineurin-fused beta2 adrenergic receptor in apo state | Authors: | Jun, X. | Deposition date: | 2024-07-02 |
|
PDBID: | 9chx | Status: | PROC -- to be processed | Title: | cryo-EM structure of calcineurin-fused beta2 adrenergic receptor in carazolol bound inactive state | Authors: | Jun, X. | Deposition date: | 2024-07-02 |
|
PDBID: | 9fru | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of human Sirt2 in complex with a pyrazole-based fragment inhibitor and NAD+ | Authors: | Friedrich, F., Einsle, O., Jung, M. | Deposition date: | 2024-06-19 |
|
PDBID: | 9c8y | Status: | HPUB -- hold until publication | Title: | X-ray crystal structure of Methylorubrum extorquens Ce(III)-bound LanD | Authors: | Jung, J.J., Lin, C.-Y., Boal, A.K. | Deposition date: | 2024-06-13 |
|
PDBID: | 9fgo | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of Enterovirus 71 2A protease mutant C110A containing VP1-2A junction in the active site | Authors: | Ni, X., Koekemoer, L., Williams, E.P., Wang, S., Wright, N.D., Godoy, A.S., Aschenbrenner, J.C., Balcomb, B.H., Lithgo, R.M., Marples, P.G., Fairhead, M., Thompson, W., Kirkegaard, K., Fearon, D., Walsh, M.A., von Delft, F. | Deposition date: | 2024-05-24 |
|
PDBID: | 9fdt | Status: | HPUB -- hold until publication | Title: | Crystal structure of human Sirt2 in complex with a pyrazole-based fragment inhibitor | Authors: | Friedrich, F., Einsle, O., Jung, M. | Deposition date: | 2024-05-17 |
|
PDBID: | 9fdu | Status: | HPUB -- hold until publication | Title: | Crystal structure of human Sirt2 in complex with a pyridine-3-carbothioamide-based fragment inhibitor | Authors: | Friedrich, F., Einsle, O., Jung, M. | Deposition date: | 2024-05-17 |
|
PDBID: | 9fdr | Status: | HPUB -- hold until publication | Title: | Crystal structure of human Sirt2 in apo form with opened selectivity pocket | Authors: | Friedrich, F., Einsle, O., Jung, M. | Deposition date: | 2024-05-17 |
|
PDBID: | 9fdw | Status: | HPUB -- hold until publication | Title: | Crystal structure of human Sirt2 in complex with a 3-chlorobenzamide-based fragment inhibitor | Authors: | Friedrich, F., Einsle, O., Jung, M. | Deposition date: | 2024-05-17 |
|
PDBID: | 9fds | Status: | HPUB -- hold until publication | Title: | Crystal structure of human Sirt2 in complex with SirReal2 | Authors: | Friedrich, F., Einsle, O., Jung, M. | Deposition date: | 2024-05-17 |
|
PDBID: | 9fdx | Status: | HPUB -- hold until publication | Title: | Crystal structure of human Sirt2 in complex with the peptide-based inhibitor KT9 | Authors: | Friedrich, F., Schutkowski, M., Einsle, O., Jung, M. | Deposition date: | 2024-05-17 |
|
PDBID: | 8zgq | Status: | AUTH -- processed, waiting for author review and approval | Title: | PvdL-E2-C3-A3-PCP3 in complex with MLP (NRPS cross-module) | Authors: | Wei, C., Jialiang, W., Zhijun, W. | Deposition date: | 2024-05-09 |
|
PDBID: | 8zeu | Status: | AUTH -- processed, waiting for author review and approval | Title: | CryoEM structure of GR2002-F(ab'')2: TSLP complex | Authors: | Zhigang, L., Junjie, H. | Deposition date: | 2024-05-07 |
|
PDBID: | 9exn | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | The vaccinia minimal RNA polymerase cryo EM structure at 1.9A resolution | Authors: | Grimm, C., Jungwirth, S., Fischer, U. | Deposition date: | 2024-04-08 |
|
PDBID: | 9eom | Status: | HPUB -- hold until publication | Title: | 250A Vipp1 dL10Ala helical tubes in the presence of EPL | Authors: | Junglas, B., Sachse, C. | Deposition date: | 2024-03-15 |
|
PDBID: | 9eon | Status: | HPUB -- hold until publication | Title: | 270A Vipp1 dL10Ala helical tubes in the presence of EPL | Authors: | Junglas, B., Sachse, C. | Deposition date: | 2024-03-15 |
|
PDBID: | 9eoo | Status: | HPUB -- hold until publication | Title: | 260A Vipp1 dL10Ala helical tubes in the presence of EPL | Authors: | Junglas, B., Sachse, C. | Deposition date: | 2024-03-15 |
|
PDBID: | 9eop | Status: | HPUB -- hold until publication | Title: | 270A Vipp1 dL10Ala helical tubes in the presence of EPL | Authors: | Junglas, B., Sachse, C. | Deposition date: | 2024-03-15 |
|
PDBID: | 9em7 | Status: | HPUB -- hold until publication | Title: | Oligomeric structure of SynDLP in presence of GTP | Authors: | Junglas, B., Gewehr, L., Schoennenbeck, P., Schneider, D., Sachse, C. | Deposition date: | 2024-03-07 |
|
PDBID: | 9em8 | Status: | HPUB -- hold until publication | Title: | Oligomeric structure of SynDLP in presence of GDP | Authors: | Junglas, B., Gewehr, L., Schoennenbeck, P., Schneider, D., Sachse, C. | Deposition date: | 2024-03-07 |
|
PDBID: | 9em9 | Status: | HPUB -- hold until publication | Title: | Structure of SynDLP MGD with GMPPNP | Authors: | Junglas, B., Gewehr, L., Schoennenbeck, P., Schneider, D., Sachse, C. | Deposition date: | 2024-03-07 |
|
PDBID: | 9au7 | Status: | HPUB -- hold until publication | Title: | Human Retriever VPS35L/VPS29/VPS26C complex bound to SNX17 peptide (Composite Map) | Authors: | Chen, B., Chen, Z., Han, Y., Boesch, D.J., Juneja, P., Burstein, E., Fung, H.Y.J. | Deposition date: | 2024-02-28 |
|
PDBID: | 8xzu | Status: | HPUB -- hold until publication | Title: | HosA transcriptional regulator from enteropathogenic Escherichia coli O127:H6 (strain E2348/69) bound with 4-hydroxy benzoic acid - Conformation II at 2.33 angstrom resolution | Authors: | Manjunath, K., Goswami, A. | Deposition date: | 2024-01-21 | Sequence: | >Entity 1 MALRNKAFHQLRQLFQQHTARWQHELPDLTKPQYAVMRAIADKPGIEQVALIEAAVSTKATLAEMLARMENRGLVRREHDAADKRRRFVWLTAEGEKVLAAAIPIGDSVDEEFLGRLSAEEQELFMQLVRKMMNTLEHHHHHH
|
|
PDBID: | 8rcx | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Crystal structure of the Mycobacterium tuberculosis regulator VirS (N-terminal fragment 4-208) in complex with the drug candidate alpibectir | Authors: | Edoo, Z., Frita, R., Grosse, C., Bourotte, M., Moune, M., Antoine, R., Trebosc, V., Schellhorn, B., Dreneau, A., Hofmann, L., Kemmer, C., Lociuro, S., Dale, G.E., Jung, F., Perez-Herran, E., Mendoza, A., Rebollo Lopez, M.J., Ghidelli-Disse, S., Drewes, G., Mathys, V., Soetaert, K., Megalizzi, V., Wintjens, R., Barros Aguirre, D., Remuinan, M.D., Gitzinger, M., Deprez, B., Willand, N., Pieren, M., Baulard, A.R. | Deposition date: | 2023-12-07 |
|