Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9dvf
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of the native PLP synthase subunit PdxS from Methanosarcina acetivorans
Authors:Agnew, A., Humm, E., Zhou, K., Gunsalus, R., Zhou, Z.H.
Deposition date:2024-10-07
PDBID:9dp6
Status:AUTH -- processed, waiting for author review and approval
Title:Mycolicibacterium smegmatis MmpL5-AcpM structure
Authors:Maharjan, R., Klenotic, P.A., Zhang, Z., Yu, E.W.
Deposition date:2024-09-20
PDBID:9dla
Status:HPUB -- hold until publication
Title:Streptococcus pneumoniae GAPN with NADP+
Authors:Eunjeong, L., Elan, Z.E.
Deposition date:2024-09-10
PDBID:9dlc
Status:HPUB -- hold until publication
Title:Streptococcus pneumoniae GAPN with G3P
Authors:Eunjeong, L., Elan, Z.E.
Deposition date:2024-09-10
PDBID:9dlb
Status:HPUB -- hold until publication
Title:Streptococcus pneumoniae apo GAPN
Authors:Eunjeong, L., Elan, Z.E.
Deposition date:2024-09-10
PDBID:9d62
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of Human Galectin-3 CRD in complex with Lactose (native)
Authors:dos Santos, L.V., Dias, I.P., Mazepa, E., Minella, T.F., Baruffi, M.R., Mestriner, L., Nascimento, A.F.Z., Albuquerque, L.J.C., Mischiatti, K.L., Winnischofer, S.M.B., Amaral, S.S., Silveira, J.L.M., Picheth, G.F.
Deposition date:2024-08-14
PDBID:9d63
Status:PROC -- to be processed
Title:Crystal structure of Human Galectin-3 CRD in complex with Galactose (Galactose soak)
Authors:dos Santos, L.V., Dias, I.P., Mazepa, E., Minella, T.F., Baruffi, M.R., Mestriner, L., Nascimento, A.F.Z., Albuquerque, L.J.C., Mischiatti, K.L., Winnischofer, S.M.B., Amaral, S.S., Silveira, J.L.M., Picheth, G.F.
Deposition date:2024-08-14
PDBID:9d64
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of Human Galectin-3 CRD in complex with Galacturonic acid (Galacturonic acid soak)
Authors:dos Santos, L.V., Dias, I.P., Mazepa, E., Minella, T.F., Baruffi, M.R., Mestriner, L., Nascimento, A.F.Z., Albuquerque, L.J.C., Mischiatti, K.L., Winnischofer, S.M.B., Amaral, S.S., Silveira, J.L.M., Picheth, G.F.
Deposition date:2024-08-14
PDBID:9iiq
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of 117 Fab-E complex
Authors:Zhao, H., Deng, Z.
Deposition date:2024-06-21
PDBID:9iiz
Status:HPUB -- hold until publication
Title:Cryo-EM Structure of EfPiwi-piRNA-target (25-nt, comma)
Authors:Li, Z.Q., Xu, Q.K., Wu, J.P., Shen, E.Z.
Deposition date:2024-06-21
PDBID:9c8d
Status:HPUB -- hold until publication
Title:mouse Seipin/Adig complex
Authors:Li, C., Han, Y., Wynn, R.M., Chen, Z., Scherer, P.E.
Deposition date:2024-06-12
PDBID:9c8e
Status:HPUB -- hold until publication
Title:mouse Seipin complex
Authors:Li, C., Han, Y., Wynn, R.M., Chen, Z., Scherer, P.E.
Deposition date:2024-06-12
PDBID:8z7g
Status:HPUB -- hold until publication
Title:Cryo-EM structure of SARS-CoV-2 S trimer in the early fusion intermediate conformation (E-FIC) (focused refinement of intact S2)
Authors:Liu, Z., Xing, L.
Deposition date:2024-04-20
PDBID:8z7l
Status:HPUB -- hold until publication
Title:Cryo-EM structure of SARS-CoV-2 S trimer in the early fusion intermediate conformation (E-FIC) (focused refinement of S-bottom)
Authors:Liu, Z., Xing, L.
Deposition date:2024-04-20
PDBID:8z7p
Status:HPUB -- hold until publication
Title:Cryo-EM structure of SARS-CoV-2 S trimer in the early fusion intermediate conformation (E-FIC)
Authors:Liu, Z., Xing, L.
Deposition date:2024-04-20
PDBID:8z7b
Status:HPUB -- hold until publication
Title:Cryo-EM structure of SARS-CoV-2 S trimer in the early fusion intermediate conformation (E-FIC) (focused refinement of NTD-SD1-RBD-ACE2)
Authors:Liu, Z., Xing, L.
Deposition date:2024-04-19
PDBID:9aw5
Status:AUTH -- processed, waiting for author review and approval
Title:Yeast 20S proteasome soaked with MA9 fraction E/F
Authors:Meneghello, R., Rustiguel, J.K., Fernandes, A.Z.N., Trivella, D.B.B.
Deposition date:2024-03-05
PDBID:9au7
Status:HPUB -- hold until publication
Title:Human Retriever VPS35L/VPS29/VPS26C complex bound to SNX17 peptide (Composite Map)
Authors:Chen, B., Chen, Z., Han, Y., Boesch, D.J., Juneja, P., Burstein, E., Fung, H.Y.J.
Deposition date:2024-02-28
PDBID:8vxl
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal Structure of the External Aldimine Complex of Pyridoxal-5''-Tetrazole and (S)-4-amino-5-phenoxypentanoate with the Bacillus subtilis GabR C-terminal Effector-binding and Oligomerization Domain
Authors:Kaley, N.E., Liveris, Z.J., Becker, D.P., Liu, D.
Deposition date:2024-02-05
PDBID:8vwf
Status:AUTH -- processed, waiting for author review and approval
Title:Anisomycin-induced collided mammalian ribosomes
Authors:Loerch, S., Petrossian, E., Smith, P.R., Campbell, Z.T.
Deposition date:2024-02-01
PDBID:8vvp
Status:AUTH -- processed, waiting for author review and approval
Title:Codon sampling state obtained from Anisomycin-treated mammalian ribosomes
Authors:Loerch, S., Petrossian, E., Smith, P.R., Campbell, Z.T.
Deposition date:2024-01-31
PDBID:8vvu
Status:AUTH -- processed, waiting for author review and approval
Title:Anisomycin-bound mammalian ribosome with partially accommodated A-site tRNA
Authors:Loerch, S., Petrossian, E., Smith, P.R., Campbell, Z.T.
Deposition date:2024-01-31
PDBID:8rmy
Status:HPUB -- hold until publication
Title:Transglutaminase 3 in complex with inhibitor Z-don and DH patient-derived Fab DH63-A02
Authors:Heggelund, J.E., Sollid, L.M.
Deposition date:2024-01-09
PDBID:8rcx
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Crystal structure of the Mycobacterium tuberculosis regulator VirS (N-terminal fragment 4-208) in complex with the drug candidate alpibectir
Authors:Edoo, Z., Frita, R., Grosse, C., Bourotte, M., Moune, M., Antoine, R., Trebosc, V., Schellhorn, B., Dreneau, A., Hofmann, L., Kemmer, C., Lociuro, S., Dale, G.E., Jung, F., Perez-Herran, E., Mendoza, A., Rebollo Lopez, M.J., Ghidelli-Disse, S., Drewes, G., Mathys, V., Soetaert, K., Megalizzi, V., Wintjens, R., Barros Aguirre, D., Remuinan, M.D., Gitzinger, M., Deprez, B., Willand, N., Pieren, M., Baulard, A.R.
Deposition date:2023-12-07
PDBID:8r27
Status:HPUB -- hold until publication
Title:Pim1 in complex with (Z)-4-(1-cyano-2-(4-hydroxyphenyl)vinyl)benzoic acid and Pimtide
Authors:Hochban, P.M.M., Heine, A., Diederich, W.E.
Deposition date:2023-11-03
Sequence:

>Entity 1


SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS

>Entity 2


ARKRRRHPSGPPTA

 

12>

226262

数据于2024-10-16公开中

PDB statisticsPDBj update infoContact PDBjnumon