| PDBID: | 9hhr | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of VSV-Indiana glycoprotein (MUDD-SUMMERS strain) in its post-fusion conformation in complex with 8G5F11 Fab | | Authors: | Albertini, A., Minoves, M.J., OuldAli, M., Gaudin, Y., Schoehn, G., Zarkadas, E. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9hhn | | Status: | HPUB -- hold until publication | | Title: | [FeFe]-hydrogenase I from Clostridium pasteurianum (CpI), variant T275Y | | Authors: | Veliju, A., Duan, J., Hofmann, E., Happe, T. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9egi | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of EgtUC binding domain mutant T274G bound to L-Ergothioneine from S. pneumoniae | | Authors: | Legg, K.A., Gonzalez-Gutierrez, G., Giedroc, D.P. | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9egj | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of EgtUC binding domain mutant I243P bound to L-Ergothioneine from S. pneumoniae | | Authors: | Legg, K.A., Gonzalez-Gutierrez, G., Giedroc, D.P. | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9egh | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of EgtUC binding domain mutant I243A bound to L-Ergothioneine from S. pneumoniae | | Authors: | Legg, K.A., Gonzalez-Gutierrez, G., Giedroc, D.P. | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hhg | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9hhi | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease without zinc of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9hhh | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease C111S of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9efn | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of Saccharomyces cerevisiae cross-linked Sfh1 (K197C, F233C) mutant in complex with phosphatidylethanolamine | | Authors: | Green, S.M., Laganowsky, A., Krieger, I., Singh, P.K., Sacchettini, J., Igumenova, T.I., Bankaitis, V.A. | | Deposition date: | 2024-11-20 | | Release date: | 2026-05-19 |
|
| PDBID: | 9efp | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of Saccharomyces cerevisiae Sec14p in complex with phosphatidylcholine | | Authors: | Green, S.M., Laganowsky, A., Krieger, I., Singh, P.K., Sacchettini, J., Igumenova, T.I., Bankaitis, V.A. | | Deposition date: | 2024-11-20 | | Release date: | 2025-11-20 |
|
| PDBID: | 9efl | | Status: | HPUB -- hold until publication | | Title: | Structure of a GH16_17 carrageenase from a metagenomic dataset. | | Authors: | Boraston, A.B., Tingley, J., Mihalynuk, L., Abbott, D.W. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9ko1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a novel alpha/beta hydrolase mutant from from Pyrinomonas methylaliphatogenes | | Authors: | Li, W.S., Jian, G., Wu, P., Chen, Y.Y., Li, Q., Han, X., Liu, W. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9knr | | Status: | HPUB -- hold until publication | | Title: | PSI-SOD supercomplex from Chromera velia | | Authors: | Feng, Y., Huang, K., Li, X.B., Amunts, A. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ko0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a novel alpha/beta hydrolase from Pyrinomonas methylaliphatogenes | | Authors: | Jian, G., Li, W.S., Wei, H.L., Li, Q., Chen, Y.Y., Wu, P., Han, X., Liu, W. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9hge | | Status: | HPUB -- hold until publication | | Title: | PB1 domain of p62/SQSTM1 | | Authors: | Berkamp, S., Jungbluth, L., Katranidis, A., Mostafavi, S., Sachse, C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9edu | | Status: | HPUB -- hold until publication | | Title: | Streptavidin-S112C bound to Cu(II)dpea cofactor | | Authors: | Minnetian, N.M., Borovik, A.S., Follmer, A.H. | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9edf | | Status: | HPUB -- hold until publication | | Title: | Streptavidin-S112C-L124F bound to Cu(II)dpea cofactor | | Authors: | Minnetian, N.M., Borovik, A.S., Follmer, A.H. | | Deposition date: | 2024-11-17 | | Release date: | 2026-05-16 |
|
| PDBID: | 9edg | | Status: | HPUB -- hold until publication | | Title: | Streptavidin-WT bound to Cu(II)dpea cofactor | | Authors: | Minnetian, N.M., Borovik, A.S., Follmer, A.H. | | Deposition date: | 2024-11-17 |
|
| PDBID: | 9edr | | Status: | HPUB -- hold until publication | | Title: | Tubulin Cofactors D,E,G,C and Tubulin complex -- TBCC N Terminus Bound to Tubulin | | Authors: | Taheri, A., Al-bassam, J. | | Deposition date: | 2024-11-17 |
|
| PDBID: | 9edh | | Status: | HPUB -- hold until publication | | Title: | Streptavidin-S112C-T114F bound to Cu(II)dpea cofactor | | Authors: | Minnetian, N.M., Borovik, A.S., Follmer, A.H. | | Deposition date: | 2024-11-17 |
|
| PDBID: | 9edi | | Status: | HPUB -- hold until publication | | Title: | Streptavidin-S112C-L124A bound to Cu(II)dpea cofactor | | Authors: | Minnetian, N.M., Borovik, A.S., Follmer, A.H. | | Deposition date: | 2024-11-17 |
|
| PDBID: | 9edk | | Status: | HPUB -- hold until publication | | Title: | Streptavidin-S112C-T114V bound to Cu(II)dpea cofactor | | Authors: | Minnetian, N.M., Borovik, A.S., Follmer, A.H. | | Deposition date: | 2024-11-17 |
|
| PDBID: | 9kmo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HR1 domain from HCoV-OC43 in complex with a pan-CoV inhibitor EK1 | | Authors: | Yan, L. | | Deposition date: | 2024-11-16 |
|
| PDBID: | 9hfj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the NTE domain of SusCdex (BT3090) dextran transporter | | Authors: | Feasey, M., Basle, A., van den Berg, B. | | Deposition date: | 2024-11-16 |
|
| PDBID: | 9ecu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the inactive BRAF/MEK1 complex bound to IK-595 | | Authors: | Yang, A. | | Deposition date: | 2024-11-15 |
|
