| PDBID: | 9el2 | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) T151I in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9el3 | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) T164A in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ekp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of WDR55 in complex with XS381774 | | Authors: | Chen, U.H., Li, F., Zeng, H., Ahmad, H., Wang, X., Sun, J., Dong, A., Seitova, A., Arrowsmith, C.H., Edwards, A.M., Peng, H., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-12-03 | | Sequence: | >Entity 1
SMEAPTRIRDTPEDIVLEAPASGLAFHPARDLLAAGDVDGDVFVFSYSCQEGETKELWSSGHHLKACRAVAFSEDGQKLITVSKDKAIHVLDVEQGQLERRVSKAHGAPINSLLLVDENVLATGDDTGGIRLWDQRKEGPLMDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCMVPVTESLLCTGSTDGVIRAVNILPNRVVGSVGQHTGEPVEELALSHCGRFLASSGHDQRLKFWDMAQLRAVVVDD
|
|
| PDBID: | 9hk6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IMPDH from Burkholderia thailandensis | | Authors: | Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hk7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IMPDH from Burkholderia thailandensis | | Authors: | Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hk9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IMPDH from Burkholderia thailandensis | | Authors: | Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hka | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IMPDH from Burkholderia thailandensis | | Authors: | Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hkb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IMPDH from Burkholderia thailandensis | | Authors: | Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hkc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IMPDH from Burkholderia thailandensis | | Authors: | Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hk8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IMPDH from Burkholderia thailandensis | | Authors: | Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ek9 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the mutant (R140Q) IDH2 homodimer | | Authors: | Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M. | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9eki | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Michaelis complex of the mutant (R140Q) IDH2 homodimer | | Authors: | Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M. | | Deposition date: | 2024-12-02 | | Release date: | 2026-06-01 |
|
| PDBID: | 9ekj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the mutant (R140Q) IDH2 homodimer in complex with clonixin | | Authors: | Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M. | | Deposition date: | 2024-12-02 | | Release date: | 2026-06-01 |
|
| PDBID: | 9ekl | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Michaelis complex of the mutant (R140Q, I319M) IDH2 homodimer | | Authors: | Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M. | | Deposition date: | 2024-12-02 | | Release date: | 2026-06-01 |
|
| PDBID: | 9ejw | | Status: | HPUB -- hold until publication | | Title: | MCMV immunoevasin m11 binding murine CD44 | | Authors: | Deuss, F.A., Rossjohn, J., Sng, X.Y.X., Voigt, V., Schuster, I.S., Fleming, P., Abuwarwar, M., van Dommelen, S., Neate, G., Horsnell, H.L., Golzarroshan, B., Varelias, A., Hill, G.R., Lyman, S.D., Mueller, S.N., Scalzo, A.A., Wikstrom, M.E., Berry, R., Fletcher, A.L., Andoniou, C.E., Degli-Esposti, M.A. | | Deposition date: | 2024-11-29 |
|
| PDBID: | 9hjm | | Status: | HPUB -- hold until publication | | Title: | Porphyromonas gingivalis BAM complex | | Authors: | Madej, M., Silale, A., van den Berg, B. | | Deposition date: | 2024-11-29 |
|
| PDBID: | 9ej9 | | Status: | HPUB -- hold until publication | | Title: | Human FANCJ helicase bound to a parallel G4 DNA | | Authors: | You, Q., Li, H. | | Deposition date: | 2024-11-27 | | Release date: | 2026-05-26 |
|
| PDBID: | 9eja | | Status: | HPUB -- hold until publication | | Title: | Human FANCJ helicase bound to a fork DNA in the closed state | | Authors: | You, Q., Li, H. | | Deposition date: | 2024-11-27 | | Release date: | 2026-05-26 |
|
| PDBID: | 9ejb | | Status: | HPUB -- hold until publication | | Title: | Human FANCJ helicase bound to a fork DNA in the open state | | Authors: | You, Q., Li, H. | | Deposition date: | 2024-11-27 | | Release date: | 2026-05-26 |
|
| PDBID: | 9ej7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of the mutant (R140Q and I319M) IDH2 homodimer | | Authors: | Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M. | | Deposition date: | 2024-11-27 | | Release date: | 2026-06-01 |
|
| PDBID: | 9hio | | Status: | HPUB -- hold until publication | | Title: | RKEC1 DNA aptamer bound to dopamine | | Authors: | Largy, E., Kaiyum, Y.A., Chao, E.H.P., Vialet, B., Johnson, P.E., Mackereth, C.D. | | Deposition date: | 2024-11-26 | | Sequence: | >Entity 1
(DT)(DT)(DG)(DA)(DA)(DG)(DG)(DT)(DT)(DC)(DG)(DT)(DT)(DC)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DT)(DG)(DG)(DA)(DG)(DT)
|
|
| PDBID: | 9hig | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM composite structure of 70S ribosome of marine cold bacterium Pseudoalteromonas translucida (P. haloplanktis)TAC125. | | Authors: | Singh, V., Emmerich, A.G., Majumdar, S., Sanyal, S. | | Deposition date: | 2024-11-26 |
|
| PDBID: | 9hia | | Status: | HPUB -- hold until publication | | Title: | K115 acetylated human muscle pyruvate kinase, isoform M2 (PKM2), in complex with FBP | | Authors: | Pavlenko, D., Nudelman, H., Shahar, A., Arbely, E. | | Deposition date: | 2024-11-25 |
|
| PDBID: | 9hib | | Status: | HPUB -- hold until publication | | Title: | K115 acetylated human muscle pyruvate kinase, isoform M2 (PKM2) | | Authors: | Pavlenko, D., Nudelman, H., Shahar, A., Arbely, E. | | Deposition date: | 2024-11-25 |
|
| PDBID: | 9hic | | Status: | HPUB -- hold until publication | | Title: | K166 acetylated human muscle pyruvate kinase, isoform M2 (PKM2), in complex with FBP | | Authors: | Pavlenko, D., Nudelman, H., Shahar, A., Arbely, E. | | Deposition date: | 2024-11-25 |
|
