| PDBID: | 9ky2 | | Status: | HPUB -- hold until publication | | Title: | Structure of beta-arrestin2 in complex with mouse C5aR1pp | | Authors: | Banerjee, R., Yadav, R., Yadav, M.K., Ganguly, M., Mishra, S., Dalal, A., Gati, C., Shukla, A.K. | | Deposition date: | 2024-12-07 |
|
| PDBID: | 9kwx | | Status: | HPUB -- hold until publication | | Title: | Structure of mouse C5a-desArg bound mouse C5aR1 in complex with Go | | Authors: | Banerjee, R., Yadav, M.K., Yadav, R., Ganguly, M., Mishra, S., Dalal, A., Gati, C., Shukla, A.K. | | Deposition date: | 2024-12-06 |
|
| PDBID: | 9kx6 | | Status: | HPUB -- hold until publication | | Title: | Structure of human C5a-desArg bound mouse C5aR1 in complex with Go | | Authors: | Banerjee, R., Yadav, M.K., Yadav, R., Ganguly, M., Mishra, S., Dalal, A., Gati, C., Shukla, A.K. | | Deposition date: | 2024-12-06 |
|
| PDBID: | 9hlz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Translational activators Aep1, Aep2 and Atp25 in complex with mRNA and the yeast mitochondrial ribosome | | Authors: | Carlstrom, A., Rovsnik, U., Ott, M. | | Deposition date: | 2024-12-06 |
|
| PDBID: | 9hm1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GSK3b in complex with N-(4-{5-[(2-aminoethyl)sulfamoyl]thiophen-2-yl}pyridin-2-yl)cyclopropanecarboxamide inhibitor | | Authors: | Slugocka, E.A., Grygier, P., Wichur, T., Czarna, A., Wieckowska, A. | | Deposition date: | 2024-12-06 |
|
| PDBID: | 9hm0 | | Status: | HPUB -- hold until publication | | Title: | Translational activator Aep3 in complex with mRNA and the yeast mitochondrial ribosome | | Authors: | Carlstrom, A., Rovsnik, U., Ott, M. | | Deposition date: | 2024-12-06 |
|
| PDBID: | 9kvs | | Status: | HPUB -- hold until publication | | Title: | Structure of SB290157 bound to human C3aR in complex with Go (Receptor Ligand Focused map) | | Authors: | Banerjee, R., Sano, F.K., Yadav, M.K., Sawada, K., Ganguly, M., Mishra, S., Dalal, A., Nureki, O., Shukla, A.K. | | Deposition date: | 2024-12-05 |
|
| PDBID: | 9kwa | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of proline dipeptidase from Pyrococcus furiosus complexed with Mn | | Authors: | Kinkar, O.U., Chandravanshi, K., Kumar, A., Makde, R.D. | | Deposition date: | 2024-12-05 | | Sequence: | >Entity 1
MASWSHPQFEKGSSHHHHHHSSGSGGGGGENLYFQGTRGNQKIFRKRMERFQEALKEKDIDAAVIRTLSTFIYLTGTKWLRPSLFVPAEGEPTVFVVKGEAEEFKRRSWIENVVEFQKVEDLMAGVVKLIQSSGARRVGLEFGVERDAYLLFFKMFQRLNPTVEVVDILDITMGMRMIKDEWEIENIRKAAKIANKGMKVAEEIIKPGLSELEIAAEIYRELMLNGSEDPKVYVSTTPRAHAEPFRDLKVKENSVVTVVIGTDWNHYYANMARTFVVGEPNERVKKAIEVKEKALEIALEETKVGVPLNSVERKLFQFFKENGFEDSYLAGYTHGVGLLIEEPPMPTIVVPTRATKVAENMVLSIIHTPLMIPEGAIKHEDTYLVKKDELEKLT
|
|
| PDBID: | 9kw9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of proline dipeptidase from Pyrococcus furiosus complexed with Co | | Authors: | Kinkar, O.U., Chandravanshi, K., Kumar, A., Makde, R.D. | | Deposition date: | 2024-12-05 | | Sequence: | >Entity 1
GTRGNQKIFRKRMERFQEALKEKDIDAAVIRTLSTFIYLTGTKWLRPSLFVPAEGEPTVFVVKGEAEEFKRRSWIENVVEFQKVEDLMAGVVKLIQSSGARRVGLEFGVERDAYLLFFKMFQRLNPTVEVVDILDITMGMRMIKDEWEIENIRKAAKIANKGMKVAEEIIKPGLSELEIAAEIYRELMLNGSEDPKVYVSTTPRAHAEPFRDLKVKENSVVTVVIGTDWNHYYANMARTFVVGEPNERVKKAIEVKEKALEIALEETKVGVPLNSVERKLFQFFKENGFEDSYLAGYTHGVGLLIEEPPMPTIVVPTRATKVAENMVLSIIHTPLMIPEGAIKHEDTYLVKKDELEKLT
|
|
| PDBID: | 9kwg | | Status: | HPUB -- hold until publication | | Title: | Structure of mouse C5a bound mouse C5aR1 in complex with Go | | Authors: | Banerjee, R., Yadav, M.K., Yadav, R., Ganguly, M., Mishra, S., Dalal, A., Gati, C., Shukla, A.K. | | Deposition date: | 2024-12-05 |
|
| PDBID: | 9kw8 | | Status: | HPUB -- hold until publication | | Title: | Polyether epoxide hydrolase MonBI-MonBII complex with product analogue | | Authors: | Yao, M., Dosen, T., Minami, A., Ozaki, T., Maenaka, K., Kumeta, H., Oikawa, H., Ose, T. | | Deposition date: | 2024-12-05 |
|
| PDBID: | 9kw6 | | Status: | HPUB -- hold until publication | | Title: | Polyether epoxide hydrolase MonBI-MonBII complex | | Authors: | Yao, M., Oikawa, A., Minami, A., Ozaki, T., Maenaka, K., Kumeta, H., Oikawa, H., Ose, T. | | Deposition date: | 2024-12-05 |
|
| PDBID: | 9kvi | | Status: | HPUB -- hold until publication | | Title: | A Cryo_EM structure of 5_HT1A complex with DMT | | Authors: | Yuan, Q., Li, S. | | Deposition date: | 2024-12-05 |
|
| PDBID: | 9elb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of glucocerebrosidase in complex with a covalent inhibitor | | Authors: | Pluvinage, B., Boraston, A.B. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9elc | | Status: | HPUB -- hold until publication | | Title: | Structure of glucocerebrosidase in complex with a covalent inhibitor | | Authors: | Pluvinage, B., Boraston, A.B. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hku | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CREBBP histone acetyltransferase domain in complex with Acetyl-Coenzyme A | | Authors: | Mechaly, A.E., Zhang, W., Cui, G., Green, M.R., Rodrigues-Lima, F. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hkt | | Status: | HPUB -- hold until publication | | Title: | Drosophila melanogaster insulin receptor ectodomain in complex with one DILP2 molecule | | Authors: | Shafi, T., Moroz, O.V., Jenkins, H.T., Chechik, M., Isupov, M.N., Brzozowski, A.M. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9ku8 | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of P1 peptide bound with E. coli LPS | | Authors: | Mohid, S.A., Bhunia, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ekp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of WDR55 in complex with XS381774 | | Authors: | Chen, U.H., Li, F., Zeng, H., Ahmad, H., Wang, X., Sun, J., Dong, A., Seitova, A., Arrowsmith, C.H., Edwards, A.M., Peng, H., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-12-03 | | Sequence: | >Entity 1
SMEAPTRIRDTPEDIVLEAPASGLAFHPARDLLAAGDVDGDVFVFSYSCQEGETKELWSSGHHLKACRAVAFSEDGQKLITVSKDKAIHVLDVEQGQLERRVSKAHGAPINSLLLVDENVLATGDDTGGIRLWDQRKEGPLMDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCMVPVTESLLCTGSTDGVIRAVNILPNRVVGSVGQHTGEPVEELALSHCGRFLASSGHDQRLKFWDMAQLRAVVVDD
|
|
| PDBID: | 9eko | | Status: | HPUB -- hold until publication | | Title: | A chimeric hybrid protein fused with the FGFR3 Transmembrane Domain | | Authors: | Yu, Z., Kreitler, D.F., Gellman, S.H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ekr | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) R136W in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9el2 | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) T151I in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9el3 | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) T164A in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hk6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IMPDH from Burkholderia thailandensis | | Authors: | Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hk7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IMPDH from Burkholderia thailandensis | | Authors: | Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H. | | Deposition date: | 2024-12-03 |
|
