| PDBID: | 9t04 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human PIN1 bound to compound 155 | | Authors: | Elizarova, E., Morozova, I., Igashov, I., Iosub, D., Gampp, O., Schneuing, A., Testori, F., Ferraris, D.M., Riek, R., Correia, B. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9x77 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Paenibacillus kribbensis D-allose kinase | | Authors: | Kamitori, S. | | Deposition date: | 2025-10-16 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMDSNERIQGGYTIGIDIGGTNFRIGLLSEMGELRHFHIESSRLLYAEGEPQDNLRNYITSYIQKHPEAEIKGIGIGFPSVVSKDKKTVYSTPNIEGFNQVNVVDPLESALAIPVYLDNDVNFLLLTEIVAHKLERRGIVVGFYLGTGFGNSIYYEDHFIAGKHGSAAELGHVPVLGRQDLCSCGNPGCIEQYASGKRLRELHELHFAGTPFEDIFVKYGSHEIIQDFLEAVAVVIATEINILDPDYIVLGGGVLHMSGFPKKELEAKIYSHARKPFPAEGLNYIYAKDNQEAGVIGAGYRAWRGNSPALIK
|
|
| PDBID: | 9x7a | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Paenibacillus kribbensis D-allulose-6-phosphate 3-epimerase | | Authors: | Kamitori, S. | | Deposition date: | 2025-10-16 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMKKHLFSPSLMCMNLMDIENQLKVLNQRADMVHIDIMDGHYVKNITLSPYFMEQIRESLTIPMDVHLMVEKPSEFIKMIIDAGATYISPHAEVINSEAFRMIDTIKSAGCKAGIALNPATPLSHIQHYIHHLDKITFMSVDPGFAGQKFIPEVLDKIREARALKEKHGYNYLIEIDGSCNEKTFKILEEAGVEVFIVGTSGLFNLDSDLNKAWDQMMEHFNSQVNAEV
|
|
| PDBID: | 9x79 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Paenibacillus kribbensis D-ribose-5-phosphate isomerase B | | Authors: | Kamitori, S. | | Deposition date: | 2025-10-16 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMRIAIGSDHVAIELKAIISAYVNELGHEVMDYGPKTSERTDYPKYGKLVAEAVVGKQADAGILICGTGVGISISANKVKGIRAVVCSEPYSAQLSKQHNNTNVLAFGARVVGSELAKMIVKAWLEAEFEGGRHGDRIKMISDIEEQHLC
|
|
| PDBID: | 9yq6 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the parainfluenza virus hemagglutinin-neuraminidase protein in complex with the human antibodies PIV3HN-09 and PIV3HN-13 | | Authors: | McCaffrey, K.D., Mousa, J.J. | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9x6n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Klebsiella oxytoca ribitol dehydrogenase in complex with D-allulose | | Authors: | Yoshida, H., Yoshihara, A. | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9sz7 | | Status: | HOLD -- hold until a certain date | | Title: | CryoEM structure of MraZ in complex with 4 box promoter from Mycoplasma genitalium | | Authors: | Reverter, D., Sanchez-Alba, L., Durand, A. | | Deposition date: | 2025-10-14 | | Release date: | 2026-10-14 |
|
| PDBID: | 9sz5 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of bacteriophage T5 L-shaped tail fiber : fiber domain | | Authors: | d''Acapito, A., Linares, R., Breyton, C. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9ypg | | Status: | PROC -- to be processed | | Title: | GTPBP1*GCP*Phe-tRNA*ribosome in the GTPase activation-like state, Structure III | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9ypo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | GTPBP1*GCP*Phe-tRNA*ribosome in the open state, Structure IIa | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9yps | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | GTPBP1*GCP*Phe-tRNA*ribosome in the open state, Structure IIb | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9ypt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | GTPBP1*GCP*Phe-tRNA*ribosome in the open state, Structure IIc | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9ypv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | GTPBP1*GCP*Phe-tRNA*ribosome in the open state, Structure IId | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9ypw | | Status: | PROC -- to be processed | | Title: | GTPBP1*GDP*Phe-tRNA*ribosome in the post-GTP hydrolysis state, Structure IV | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9ypy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ribosome with accommodated A-site tRNA, Structure V | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9ypz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Vacant ribosome with P-site tRNA, substate 1, Structure Ia | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9yq0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Vacant ribosome with P-site tRNA, substate 2, Structure Ib | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9yq1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Vacant ribosome with P-site tRNA, substate 3, Structure Ic | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9syh | | Status: | HPUB -- hold until publication | | Title: | E. coli 70S ribosome from deltaRlmE strain | | Authors: | Larsson, D.S.D., Selmer, M. | | Deposition date: | 2025-10-12 |
|
| PDBID: | 9syd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Beyond single-state RNA structural biology: MD/NMR description of temperature-sensitive dynamic RNA ensembles - GCAA ARIA 1+3 motif | | Authors: | Leopold, D., Oxenfarth, A., Thomasen, F.E., Kuemmerer, F., Schnieders, R., Pinter, G., Wacker, A., Jonker, H.R.A., Fuertig, B., Richter, C., Lindorff-Larsen, K., Schwalbe, H. | | Deposition date: | 2025-10-11 |
|
| PDBID: | 9syc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Beyond single-state RNA structural biology: MD/NMR description of temperature-sensitive dynamic RNA ensembles - GAAG reweighted MD subensemble | | Authors: | Leopold, D., Oxenfarth, A., Thomasen, F.E., Kuemmerer, F., Schnieders, R., Pinter, G., Wacker, A., Jonker, H.R.A., Fuertig, B., Richter, C., Lindorff-Larsen, K., Schwalbe, H. | | Deposition date: | 2025-10-11 |
|
| PDBID: | 9syf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Beyond single-state RNA structural biology: MD/NMR description of temperature-sensitive dynamic RNA ensembles - GCAA MD conformational ensemble | | Authors: | Leopold, D., Oxenfarth, A., Thomasen, F.E., Kuemmerer, F., Schnieders, R., Pinter, G., Wacker, A., Jonker, H.R.A., Fuertig, B., Richter, C., Lindorff-Larsen, K., Schwalbe, H. | | Deposition date: | 2025-10-11 |
|
| PDBID: | 9sye | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Beyond single-state RNA structural biology: MD/NMR description of temperature-sensitive dynamic RNA ensembles - GCAA ARIA 2+2 motif | | Authors: | Leopold, D., Oxenfarth, A., Thomasen, F.E., Kuemmerer, F., Schnieders, R., Pinter, G., Wacker, A., Jonker, H.R.A., Fuertig, B., Richter, C., Lindorff-Larsen, K., Schwalbe, H. | | Deposition date: | 2025-10-11 |
|
| PDBID: | 9x4p | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | photosystem I with six LHCIfrom a green alga as lichen phycobiont | | Authors: | Su, X.D., Wei, X.L., Li, M. | | Deposition date: | 2025-10-11 |
|
| PDBID: | 9x4o | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | photosystem I with eight LHCI from a green alga as lichen phycobiont | | Authors: | Su, X.D., Wei, X.L., Li, M. | | Deposition date: | 2025-10-11 |
|
