| PDBID: | 9gki | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of 5mer pore intermediate of Sticholysin II (StnII) toxin in lipid nanodiscs | | Authors: | Martin Benito, J., Santiago, C., Carlero, D. | | Deposition date: | 2024-08-25 | | Release date: | 2025-08-25 |
|
| PDBID: | 9gkk | | Status: | HPUB -- hold until publication | | Title: | BetP heterotrimeric complex | | Authors: | Urbansky, K., Fu, L., Madej, M.G., Ziegler, C. | | Deposition date: | 2024-08-25 |
|
| PDBID: | 9gkj | | Status: | HPUB -- hold until publication | | Title: | Human TPC2 in Complex with Agonist and Metal Ion | | Authors: | Specht, T., Mayer, B., Fu, L., Urbansky, K., Madej, M.G., Ziegler, C. | | Deposition date: | 2024-08-25 |
|
| PDBID: | 9gkl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the octameric pore of Fragaceotxin C (FraC or DELTA-actitoxin-Afr1a) in large unilamellar vesicles. | | Authors: | Martin Benito, J., Santiago, C., Carlero, D., Arranz, R. | | Deposition date: | 2024-08-25 | | Release date: | 2025-08-25 |
|
| PDBID: | 9gkp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of fragacetoxin C in lipid nanodiscs | | Authors: | Martin Benito, J., Santiago, C., Arranz, R. | | Deposition date: | 2024-08-25 | | Release date: | 2025-08-25 |
|
| PDBID: | 9dc1 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Asymmetric unit of the inner core structure associated with portal in bacteriophage T7 | | Authors: | wang, C., Molineux, I.J., Liu, J. | | Deposition date: | 2024-08-25 |
|
| PDBID: | 9ja8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human phosphodiesterase 10A in complex with N-(2-amino-2-thioxoethyl)-2-(3-(3-(dimethylcarbamoyl)-6-fluoroimidazo[1,2-a]pyridin-2-yl)azetidin-1-yl)quinoline-4-carboxamide | | Authors: | Zhang, F.C., Huang, Y.Y., Luo, H.B., Guo, L. | | Deposition date: | 2024-08-24 |
|
| PDBID: | 9gkf | | Status: | HPUB -- hold until publication | | Title: | Amyloid Fibril of Heterogeneous nuclear ribonucleoprotein A1A induced by RNA binding | | Authors: | Frey, L., Riek, R.P., Arosio, P., Morelli, C. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gjy | | Status: | HPUB -- hold until publication | | Title: | Bacillus licheniformis nitroreductase | | Authors: | Crennell, S.J., Danson, M.J., Emptage, C. | | Deposition date: | 2024-08-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMTEQSKKQEILDAFQFRHATKEFDPDRKISDEDFQFILEAGRLSPSSVGLEPWQFVVVQNKELREKLRQVSWGAQGQLPTASHFVLLLGRTAKEMRRDSGYVADQLKHVKKMPEDIIENMLKEDGVLESFQDGDFHLYESDRAMFDWVSKQTYIALANMMTAAALIGIDSCPIEGFNYDKVHDILEKEGVLEDGRFDISVMAAFGYRVKEPRPKTRRALDQIVKWVE
|
|
| PDBID: | 9gjx | | Status: | HPUB -- hold until publication | | Title: | Bacillus licheniformis nitroreductase | | Authors: | Crennell, S.J., Danson, M.J., Emptage, C. | | Deposition date: | 2024-08-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMTEQSKKQEILDAFQFRHATKEFDPDRKISDEDFQFILEAGRLSPSSVGLEPWQFVVVQNKELREKLRQVSWGAQGQLPTASHFVLLLGRTAKEMRRDSGYVADQLKHVKKMPEDIIENMLKEDGVLESFQDGDFHLYESDRAMFDWVSKQTYIALANMMTAAALIGIDSCPIEGFNYDKVHDILEKEGVLEDGRFDISVMAAFGYRVKEPRPKTRRALDQIVKWVE
|
|
| PDBID: | 9db7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NDM-1 complexed with compound 21 | | Authors: | Jacobs, L.M.C., Chen, Y. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9daf | | Status: | HPUB -- hold until publication | | Title: | L-asparaginase II (EcA2-K12) | | Authors: | de Sa Ribeiro, F., Costa, A.C., Araujo, T.S., Almeida, M.S., Lima, L.M.T.R. | | Deposition date: | 2024-08-22 |
|
| PDBID: | 9dah | | Status: | HPUB -- hold until publication | | Title: | L-asparaginase II (EcA2-4M) | | Authors: | de Sa Ribeiro, F., Costa, A.C., Araujo, T.S., Almeida, M.S., Lima, L.M.T.R. | | Deposition date: | 2024-08-22 |
|
| PDBID: | 9day | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of the Transcriptional Regulator HcpR from Porphyromonas Gingivalis | | Authors: | Musayev, F.N., Escalante, C.R., Belvin, B.R., Lewis, J.P. | | Deposition date: | 2024-08-22 |
|
| PDBID: | 9dag | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NDM-1 complexed with compound 12 | | Authors: | Jacobs, L.M.C., Chen, Y. | | Deposition date: | 2024-08-22 |
|
| PDBID: | 9gj8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Sticholisin II in large unilamellar vesicles. | | Authors: | Santiago, C. | | Deposition date: | 2024-08-21 | | Release date: | 2025-02-21 |
|
| PDBID: | 9da1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human DNPH1 bound to inhibitor 1a | | Authors: | Wagner, A.G., Schramm, V.L., Almo, S.C., Ghosh, A. | | Deposition date: | 2024-08-21 | | Sequence: | >Entity 1
SMRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAAGGDRLIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADP
|
|
| PDBID: | 9da2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human DNPH1 bound to inhibitor 1b | | Authors: | Wagner, A.G., Schramm, V.L., Almo, S.C., Ghosh, A. | | Deposition date: | 2024-08-21 |
|
| PDBID: | 9da3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human DNPH1 bound to inhibitor 2a | | Authors: | Wagner, A.G., Schramm, V.L., Almo, S.C., Ghosh, A. | | Deposition date: | 2024-08-21 |
|
| PDBID: | 9d9n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NDM-1 complexed with compound 5 | | Authors: | Jacobs, L.M.C., Chen, Y. | | Deposition date: | 2024-08-21 |
|
| PDBID: | 9da4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human DNPH1 bound to inhibitor 2b | | Authors: | Wagner, A.G., Schramm, V.L., Almo, S.C., Ghosh, A. | | Deposition date: | 2024-08-21 |
|
| PDBID: | 9da5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human DNPH1 bound to inhibitor 2c | | Authors: | Wagner, A.G., Schramm, V.L., Almo, S.C., Ghosh, A. | | Deposition date: | 2024-08-21 |
|
| PDBID: | 9da6 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of human DNPH1 bound to inhibitor 3a | | Authors: | Wagner, A.G., Schramm, V.L., Almo, S.C., Ghosh, A. | | Deposition date: | 2024-08-21 |
|
| PDBID: | 9j7x | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of quintuple mutant C terminal fragment of Clostridium perfringens enterotoxin (C-CPEm19) | | Authors: | Aoyama, H. | | Deposition date: | 2024-08-20 | | Release date: | 2025-08-20 |
|
| PDBID: | 9j88 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structures and mechanisms of serine protease inhibitors of Trichinella spiralis and Trichinella pseudospiralis | | Authors: | Chen, C., Xue, L.R. | | Deposition date: | 2024-08-20 |
|
