| PDBID: | 9ydk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Dickerson dodecamer RNA duplex containing a modified base with a 2-F-6-aminopurine/G mismatch. | | Authors: | Harp, J.M., Egli, M. | | Deposition date: | 2025-09-22 |
|
| PDBID: | 9ydn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human NRAS specific T cell receptor N17.2 | | Authors: | Gallagher, D.T., Sharma, V.K., Mariuzza, R.A. | | Deposition date: | 2025-09-22 | | Release date: | 2026-09-22 |
|
| PDBID: | 9ydf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the cyclic nucleotide binding domain of SLC9C1 | | Authors: | Lyu, C., Dong, A., Chandrasekaran, R., Mamai, A., Arrowsmith, C.H., Edwards, A.M., Burgess-Brown, N., Tredup, C., Harding, R.J., Structural Genomics Consortium (SGC) | | Deposition date: | 2025-09-22 |
|
| PDBID: | 9ydg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the human DCAF1 WDR domain in complex with OICR-41074 | | Authors: | kimani, S., Dong, A., Li, Y., Seitova, A., Mamai, A., Al-awar, R., Ackloo, S., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2025-09-22 |
|
| PDBID: | 9sqf | | Status: | HPUB -- hold until publication | | Title: | PaMurU in complex with Mn2+ and UTP substrate | | Authors: | Jimenez-Faraco, E., Hermoso, J.A. | | Deposition date: | 2025-09-22 |
|
| PDBID: | 9yd2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ternary complex of DNA polymerase I from Bacillus stearothermophilus, large fragment, bound to DNA containing a thymine dimer and dATP | | Authors: | Wu, E.Y., Walsh, A.R. | | Deposition date: | 2025-09-20 |
|
| PDBID: | 9wvg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of B. subtilis YdzF in oxidized state | | Authors: | Barman, R., Baidya, A.K. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9wv9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of a dNTPase from Vibrio cholerae with GTP | | Authors: | Xu, Z.X., Zhang, K. | | Deposition date: | 2025-09-19 | | Release date: | 2026-09-19 |
|
| PDBID: | 9wvb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | A ternary complex of RLK7 with BAK1 and TOSL2 | | Authors: | Bai, Y.F., Yu, J.F., Xiao, Y. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9wvc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of a dNTPase from Vibrio cholerae with GTP | | Authors: | Xu, Z.X., Zhang, K. | | Deposition date: | 2025-09-19 | | Release date: | 2026-09-19 |
|
| PDBID: | 9wve | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA-A*11:01 in complex with KRAS G12A 10-mer peptide (VVVGAAGVGK) | | Authors: | Jiali, Z., Linlin, Z. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9wvf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA-A*11:01 in complex with KRAS G12S 10-mer peptide (VVVGASGVGK) | | Authors: | Jiali, Z., Linlin, Z. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9ycw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of USP16 ZnF-UBP domain | | Authors: | Alexandrovics, J.A., Komander, D. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9ycq | | Status: | HPUB -- hold until publication | | Title: | First Bromodomain of BRDT liganded with inhibitor GXH-IV-076 (compound 33) | | Authors: | Schonbrunn, E., Chan, A. | | Deposition date: | 2025-09-19 | | Sequence: | >Entity 1
STNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEE
|
|
| PDBID: | 9sqb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | D-stereospecific hydrolase I from Bacillus thuringiensis Berliner 1915 in complex with benzoyl-D-arginine | | Authors: | Simon, A.H., Parthier, C., Bordusa, F., Stubbs, M.T., Schoepfel, M. | | Deposition date: | 2025-09-19 | | Release date: | 2026-09-19 |
|
| PDBID: | 9sq8 | | Status: | HPUB -- hold until publication | | Title: | Structure Of IgGFc-FcRn in complex with VHH 91G06 | | Authors: | Kumar, A., Bertrand, T. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9sq7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Aurora-A bound to DBS2 | | Authors: | Miles, J.A., Bayliss, R.W. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9sqa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Aurora-A bound to DBL4 | | Authors: | Miles, J.A., Bayliss, R.W., Wallis, E.J. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9sq3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Molybdenum-containing nitrogenase from Methanocaldococcus infernus refined to 1.21 A resolution - crystalline form B. | | Authors: | Maslac, N., Torer, M.R., Bolte, P., Wagner, T. | | Deposition date: | 2025-09-19 | | Sequence: | >Entity 1
MPFVLLDCDKPIPERMKHTYIYDPEEEIIPACNIKTIPGDMTERGCSFAGARGVVGGPVKDVIHMVHGPIGCAFYTWGTRRNLSDFELHRRYCFSTDMQEADIVYGGEKKLEKACIEAAEEFPEAKGIFIYATCPTALIGDNLEAVARKVEEKIKKPVFACNSPGFAGCSQSKGHHIFNTEFYRWLRKAREKYPEKCLKEEEKTPYDIAIVGEYNMDWDLKVIKPLFEKIGCRVVAVFTGNASLDDLFKLPDVKLCVVHCQRSANYIAEMIRDGYNVPRVWVSLFGIEQTAEALRKTAEVLGIDKEKVEQVIKEEVEAIKPQLEFYKSKLEGKRCLVYVGGPRTWHWIRMFKELGVDVVVACCTFAHEDDYEKLNRNLKKAGLKGTLVIDAPNELELEEAIHKYKPDFMLTGLKERYLFRKYGVPTINSHSYEQGPYAGFRGFVNFARDIYKAVCHPIWDILKEGEKKFEEFKKKNN
>Entity 2
MGITYVEKQRAVTINPNKICQPIGAMWATLGVHRAIPFVQGSQGCCTYVRYTFNRHFREPVSIAVASFHEDAAVYGGMKNLVEGIRNLVARYDPDLISVVTTCSSETIGDDIEAFIRAARKKIAKEFGEEKAKLPIIPVHCPSYQASHVKGYDNASKAFLEYLAKKDEEKEPHKINIIPGFGVNPGDILEIKRILDMFGLKEGEDYSILFDISETLYQPLREPIKEIPYYPKGGTKVEEFVDAANAKATFALCKHAGGAGALYLQRKYKVPAYYGLPIGIKNTDDFIINIAKVTGLDIPDKLLDERGKLIDAIVDTVHYTMDKKVGIFGDPDFVIAVSRFCCEIGMKPVVVNTQTPSNTYKKAMEEIANEYNVDIEVQFSDLWDFEKSVKKIGVDLLIGHPRGGVKIAEDLGIGLVRMGFPIYDRVGYFRWPIVGYMGSLRFFDEIVNTILDTQVPWDQKQQ
|
|
| PDBID: | 9wue | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of a dNTPase from Vibrio cholerae | | Authors: | Xu, Z.X., Zhang, K. | | Deposition date: | 2025-09-18 | | Release date: | 2026-09-18 |
|
| PDBID: | 9wub | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Dicovery of SY-589, a Highly Potent and Orally Bioavailable PolQ Helicase Inhibitor, for the Treatment of HR-Deficient Tumors | | Authors: | Hu, H., Daopeng, Y. | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9wug | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of a dNTPase from Vibrio cholerae with dGTP | | Authors: | Xu, Z.X., Zhang, K. | | Deposition date: | 2025-09-18 | | Release date: | 2026-09-18 |
|
| PDBID: | 9yca | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Thermotoga maritima threonylcarbamoyl transfer complex (TsaB2D2) in complex with Escherichia coli tRNA(THR) | | Authors: | Kutchuashvili, A., Swairjo, M.A. | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9yc8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Leucine Rich Repeat Kinase 2 activate state (Apo ROC state 1) | | Authors: | Villagran Suarez, A., Bodrug, T., Leschziner, A. | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9yc2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of USP49 ZnF-UBP domain | | Authors: | Alexandrovics, J.A., Komander, D. | | Deposition date: | 2025-09-18 |
|
