| PDBID: | 9hud | | Status: | HPUB -- hold until publication | | Title: | Alpha-1-antitrypsin in the cleaved conformation in complex with a conformationally nonselective Fab fragment | | Authors: | Irving, J.A., Aldobiyan, I.F. | | Deposition date: | 2024-12-22 |
|
| PDBID: | 9mne | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of enteropathogenic Escherichia coli EspC | | Authors: | Pilapitiya, A.U., Heras, B., Paxman, J.J. | | Deposition date: | 2024-12-21 |
|
| PDBID: | 9mnf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of FBXW7 in complex with XS839193 | | Authors: | Perez, J.G., Ahmad, H., Wang, X., Sun, J., Dong, A., Seitova, A., Arrowsmith, C.H., Edwards, A.M., Peng, H., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-12-21 |
|
| PDBID: | 9huc | | Status: | HPUB -- hold until publication | | Title: | The glucuronyl esterase OtCE15A from Opitutus terrae in complex with a heptasaccharide | | Authors: | Oestberg, E.B., Lo Leggio, L., Zaghini, A., Mazurkewich, S., Larsbrink, J. | | Deposition date: | 2024-12-21 | | Sequence: | >Entity 1
MRNVLAALSLLFTLTSMQATSRPARLDDTPPPAYTLPDPLVGADGTRVHDRATWQHRRRPELLQLFAREVYGRTPLGRPEGMVFKVTTMEHAALGGAATRKEVTVRFGRDPNAPSMQLLLYVPNAVIARAERAPVFLGLNFYGNHTVHTDPAIALSARWIPAEAPNGANHRATEAARGSDAQKWPVEQILARGYAVATVYCGDLCPDRPDGLNASVASWLDAAAGDQRAPDAWGAIGVWAWGLSRALDYLETDPLVDASRVAVHGHSRLGKAALWAGAQDDRFALVISNESGCGGAALSKRIHGETVARINTVFPHWFARNFRRYDDHEEALPVDQHELLALVAPRPLYVASAEDDDWADPRGEFLAVKAAEPVFRLFGQTGPSGEDVPRVNEPSGGALRYHIRPGPHGMTAQDWAFYLAFADEWLKSALPAREPQR
|
|
| PDBID: | 9hub | | Status: | HPUB -- hold until publication | | Title: | D11 mAbs bound to alpha-Bungarotoxin at pH 7.5 | | Authors: | Wade, J.W., Bohn, M.F., Laustsen, A.H., Morth, J.P. | | Deposition date: | 2024-12-21 |
|
| PDBID: | 9l4m | | Status: | HPUB -- hold until publication | | Title: | Structure of bifunctional Ylehd at pH 8 from Yarrowia lipolytica | | Authors: | Yadav, L.R., Vanarase, K.N., Inamdar, S.S., Mande, S.C., Kumar, A.R. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9mmf | | Status: | HPUB -- hold until publication | | Title: | First structure of Five-tetrad G-Quadruplex | | Authors: | Eyiolowope, J., Xing, E.R., Yatsunyk, L.A. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9hu8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Kalirin/Rac1 in complex with MC-278. | | Authors: | Callens, M.C., Thompson, A.P., Gray, J.L., von Delft, F., Brennan, P.E. | | Deposition date: | 2024-12-20 |
|
| PDBID: | 9l3q | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 PT Spike Protein complex with a potent broad-spectrum macrocyclic peptide inhibitor 6L3-3P11K | | Authors: | Wang, M., Yang, J.Y., Peng, Q., Shi, Y. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mle | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Asp49 Phospholipase A2 isolated from Lachesis muta | | Authors: | Leonardo, D.A., Vargas, J.A., Pereira, H.M., Garratt, R.C. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mld | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the Portal Protein from Finegoldia magna phage Miquella | | Authors: | Harlington, A.H., Fechner, M.R., Hao, N., Shearwin, K.E., Whelan, F. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlj | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease covalently bound to compound GRL-050-23 at 1.6 A | | Authors: | Beechboard, S.N., Mesecar, A.D., Ghosh, A.K., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-12-19 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVT(CSO)GTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD(CSO)VSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9ht5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of YIUA from Yersinia ruckeri with Iron and nitrilotriacetic acid | | Authors: | Thompson, S., Thomsen, E., Duhme-Klair, A., Butler, A., Grogan, G. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht7 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of WT E.coli ribosome with complexed filament nascent chain at length 47, with P-site and A-site tRNAs | | Authors: | Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9hrl | | Status: | HPUB -- hold until publication | | Title: | NbE34 a VHH binding human neutrophil elastase | | Authors: | Redeghieri, P., Dumoulin, M., Kerff, F. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9hrj | | Status: | HPUB -- hold until publication | | Title: | Structure of YIUA from Yersinia ruckeri | | Authors: | Thompson, S., Thomsen, E., Duhme-Klair, A., Butler, A., Grogan, G. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9hrp | | Status: | HPUB -- hold until publication | | Title: | Structure of YIUA from Yersinia ruckeri with iron | | Authors: | Thompson, S., Thomsen, E., Duhme-Klair, A., Butler, A., Grogan, G. | | Deposition date: | 2024-12-18 | | Sequence: | >Entity 1
SENITDMAGRSVVIPAKVERILLGEGRLFYAVSLLEGQKPFDRIVGWQGDFRKLDTQTYAVYKAKFPQVDNIPLIGNTTADSISPEKVLTLNPDIAIFGLSGHGPGKNSELVKQLEKAGVPVVFVDFRTSPLKNTLPSMRVLGKVLHREQQANDYIKFYEDNVRKVTEITSKIPADKKPSVFIELRAGAMEECCGTAGKGNMGDFIDQAGGNNMAKNLLPGALGTVNLEKVLSTNPDIYIASGGKAPDNNAPGVSLGAQVTKEQAQSSLQTILDRKGINTLSAVKNGRSYGIWHNFYNSPYNVLAIQSFAKWFYPQQFADLDPNNTMNSLYSQFLAIEPTGTYWVDSTK
|
|
| PDBID: | 9hs5 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Cryo-EM structure of an agonist bound to the active melanocortin-4 receptor (MC4R) in complex with the heterotrimeric Gs protein at 3.06 A resolution. | | Authors: | Heyder, N.A., Speck, D., Schmidt, A., Hilal, T., Scheerer, P. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9l2t | | Status: | HPUB -- hold until publication | | Title: | Cryo-electron microscopic structure of a novel amidohydrolase with three mutations | | Authors: | Dai, L.H., Xu, Y.H., Hu, Y.M., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Niu, D., Guo, R.-T., Chen, C.-C. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9l36 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-electron microscopic structure of a novel amidohydrolase ADH3 triple mutation | | Authors: | Dai, L.H., He, B.Y., Hu, Y.M., Xu, Y.H., Huang, J.P., Xie, Z.Z., Li, H., Niu, D., Guo, R.-T., Chen, C.-C. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9l2o | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure and rational engineering of a novel efficient ochratoxin A-detoxifying amidohydrolase | | Authors: | Dai, L.H., Xu, Y.H., Hu, Y.M., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Niu, D., Guo, R.-T., Chen, C.-C. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9mkc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MALT1 in complex with an allosteric inhibitor | | Authors: | Bell, J.A. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9mkh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Open state of D-ornithine 4,5-aminomutase from Fervidobacterium nodosum | | Authors: | Pham, K., Poore, A., Tian, S., Vago, F. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9mkd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MALT1 in complex with an allosteric inhibitor | | Authors: | Bell, J.A. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9mke | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MALT1 in complex with an allosteric inhibitor | | Authors: | Bell, J.A. | | Deposition date: | 2024-12-17 |
|
