| PDBID: | 9v8u | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v83 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of Asparagine Synthetase from Entamoeba histolytica | | Authors: | Mishra, S., Yadav, L., Gautam, A.K., Gourinath, S. | | Deposition date: | 2025-05-29 | | Release date: | 2026-05-29 |
|
| PDBID: | 9ovf | | Status: | HPUB -- hold until publication | | Title: | Rubredoxin covalently linked to benzo-18-crown-6 | | Authors: | Adhami, N., Sawaya, M.R., Shafaat, H.S., Rodriguez, J.A., Spokoyny, A.M. | | Deposition date: | 2025-05-29 | | Sequence: | >Entity 1
MQKYVCNVCGYEYDPAEHDNVPFDQLPDDWCCPVCGVSKDQFSPA
|
|
| PDBID: | 9ova | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PKD2 ion channel, P658A mutant | | Authors: | Esarte Palomero, O., DeCaen, P.G. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ous | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | D3 Virion icos | | Authors: | Belford, A.K., Huet, A., Maurer, J.B., Duda, R.L., Conway, J.F. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9oux | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of sensory domain of CdgA in complex with VpbA (VCA0075) with 7,8-dihydroneopterin from Vibrio cholerae O1 biovar El Tor str. N16961 | | Authors: | Mariscal, V.T., Tripathi, S.M., Yildiz, F.H., Rubin, S.M. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ov3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ouq | | Status: | HPUB -- hold until publication | | Title: | Native GABA-A receptor from rat cerebella, beta1-alpha1-beta2-alpha1-gamma2 subtype, in complex with GABA | | Authors: | Sun, C., Gouaux, E. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9our | | Status: | HPUB -- hold until publication | | Title: | Native GABA-A receptor from rat cerebella, beta2-alpha1-beta2-alpha1-gamma2 subtype, in complex with GABA | | Authors: | Sun, C., Gouaux, E. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9oum | | Status: | HPUB -- hold until publication | | Title: | Native GABA-A receptor from rat cerebella, beta2-alpha1-beta1-alpha6-gamma2 subtype, in complex with GABA and PZ-II-029 | | Authors: | Sun, C., Gouaux, E. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ov6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ov5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ouo | | Status: | HPUB -- hold until publication | | Title: | Native GABA-A receptor from rat cerebella, beta1-alpha1-beta1-alpha1-gamma2 subtype, in complex with GABA and PZ-II-029 | | Authors: | Sun, C., Gouaux, E. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ov1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ouw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ov4 | | Status: | HPUB -- hold until publication | | Title: | Native GABA-A receptor from rat cerebella, beta1-alpha1-beta2-alpha1-gamma2 subtype, in complex with GABA and PZ-II-029 | | Authors: | Sun, C., Gouaux, E. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ouu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SPOP double donut locally refined MATH domains | | Authors: | Cuneo, M.J. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9out | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SPOP double donut locally refined MATH domains | | Authors: | Cuneo, M.J. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ouv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human IGG1 FC fragment-FC-gamma receptor IIB complex | | Authors: | Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ouz | | Status: | HPUB -- hold until publication | | Title: | Icosahedral D3 expanded capsid | | Authors: | Belford, A.K., Huet, A., Maurer, J.B., Duda, R.L., Conway, J.F. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ov2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human IGA2M1 FC fragment-FC-alpha receptor (CD89) complex | | Authors: | Chandravanshi, M., Korzeniowski, M., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ov9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ov7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ov8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9ovb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-29 |
|
