| PDBID: | 9r8a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PHF tau filament from the brain of a football player | | Authors: | Qi, C., Scheres, H.W.S., Goedert, M. | | Deposition date: | 2025-05-16 |
|
| PDBID: | 9r8o | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Open-state RyR1 in 0.05% POPC micelles, in complex with a nanobody and FKBP | | Authors: | Li, C., Efremov, R.G. | | Deposition date: | 2025-05-16 |
|
| PDBID: | 9uyb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ZER1 bound to GSER degron | | Authors: | Dong, C., Li, J., Zhang, B. | | Deposition date: | 2025-05-15 | | Release date: | 2026-05-15 |
|
| PDBID: | 9uyv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of VPS25 from Candidatus Prometheoarchaeum syntrophicum strain MK-D1 | | Authors: | Robinson, R.C., Naripogu, K.B. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9onn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Co-bound B. pseudomallei Rubrerythrin | | Authors: | Budziszewski, G.R., Snell, M.E., Monteiro, D.C.F., Lynch, M.L., Bowman, S.E.J. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9ono | | Status: | HPUB -- hold until publication | | Title: | Fe-bound B. pseudomallei rubrerythrin | | Authors: | Budziszewski, G.R., Snell, M.E., Monteiro, D.C.F., Lynch, M.L., Bowman, S.E.J. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9onr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | rubrerythrin- E53A E124A | | Authors: | Budziszewski, G.R., Snell, M.E., Monteiro, D.C.F., Lynch, M.L., Bowman, S.E.J. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9onm | | Status: | HPUB -- hold until publication | | Title: | near-apo rubrerythrin | | Authors: | Budziszewski, G.R., Snell, M.E., Monteiro, D.C.F., Lynch, M.L., Bowman, S.E.J. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9onh | | Status: | HPUB -- hold until publication | | Title: | Structure of ancestral-reconstructed cytochrome P450 11A1 (CYP11A1) in complex with desmosterol | | Authors: | Alves Chagas, B.C., Brixius-Anderko, S. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9onq | | Status: | HPUB -- hold until publication | | Title: | Mn-bound B. pseudomallei rubrerythrin | | Authors: | Budziszewski, G.R., Snell, M.E., Monteiro, D.C.F., Lynch, M.L., Bowman, S.E.J. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9oo5 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the dimeric YrvO cysteine desulfurase | | Authors: | Zoumpoulakis, A., Gervason, S., Venien-Bryan, C., Golinelli-Pimpaneau, B., Fernandes, C.A.H. | | Deposition date: | 2025-05-15 | | Release date: | 2025-11-15 |
|
| PDBID: | 9ont | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of a P-loop mutant PTP-like myo-inositol phosphatase from Selenomonas ruminantium in complex with myo-inositol hexakisphosphate | | Authors: | Cleland, C.P., Mosimann, S.C. | | Deposition date: | 2025-05-15 | | Release date: | 2025-11-15 |
|
| PDBID: | 9onu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of a P-loop mutant PTP-like myo-inositol phosphatase from Selenomonas ruminantium in complex with myo-inositol-(1,2,4,5,6)-pentakisphosphate | | Authors: | Cleland, C.P., Mosimann, S.C. | | Deposition date: | 2025-05-15 | | Release date: | 2025-11-15 |
|
| PDBID: | 9r84 | | Status: | HPUB -- hold until publication | | Title: | The C103F Mutant of Apo-C-Terminal Domain Homolog of the Orange Carotenoid Protein (CTDH) from Anabaena | | Authors: | Sklyar, J., Adir, N. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9on9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Immature HIV-1 CACTD-SP1 lattice with Maturation inhibitor PF-46396 (R) and Inositol hexakisphosphate (IP6) | | Authors: | Zadorozhnyi, R., Quinn, C.M., Zadrozny, K.K., Ablan, S.D., Kennedy, B.J., Yap, G.P.A., Sanner, D., Kraml, C., Freed, E.O., Ganser-Pornillos, B.K., Pornillos, O., Gronenborn, A.M., Polenova, T. | | Deposition date: | 2025-05-14 | | Release date: | 2026-05-14 |
|
| PDBID: | 9ona | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Immature HIV-1 CACTD-SP1 lattice with Maturation inhibitor PF-46396 (S) and Inositol hexakisphosphate (IP6) | | Authors: | Zadorozhnyi, R., Quinn, C.M., Zadrozny, K.K., Ablan, S.D., Kennedy, B.J., Yap, G.P.A., Sanner, D., Kraml, C., Freed, E.O., Ganser-Pornillos, B.K., Pornillos, O., Gronenborn, A.M., Polenova, T. | | Deposition date: | 2025-05-14 | | Release date: | 2026-05-14 |
|
| PDBID: | 9onb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Immature HIV-1 CACTD-SP1 lattice with Maturation inhibitor PF-46396 (S) and Inositol hexakisphosphate (IP6) | | Authors: | Zadorozhnyi, R., Quinn, C.M., Zadrozny, K.K., Ablan, S.D., Kennedy, B.J., Yap, G.P.A., Sanner, D., Kraml, C., Freed, E.O., Ganser-Pornillos, B.K., Pornillos, O., Gronenborn, A.M., Polenova, T. | | Deposition date: | 2025-05-14 | | Release date: | 2026-05-14 |
|
| PDBID: | 9on8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Immature HIV-1 CACTD-SP1 lattice with Maturation inhibitor PF-46396 (R) and Inositol hexakisphosphate (IP6) | | Authors: | Zadorozhnyi, R., Quinn, C.M., Zadrozny, K.K., Ablan, S.D., Kennedy, B.J., Yap, G.P.A., Sanner, D., Kraml, C., Freed, E.O., Ganser-Pornillos, B.K., Pornillos, O., Gronenborn, A.M., Polenova, T. | | Deposition date: | 2025-05-14 | | Release date: | 2026-05-14 |
|
| PDBID: | 9r7j | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Repair of Iron Centre (RIC) protein from Staphylococcus aureus | | Authors: | Romao, C.V., Matias, P.M., Saraiva, L.M. | | Deposition date: | 2025-05-14 | | Release date: | 2026-05-14 |
|
| PDBID: | 9r7k | | Status: | HPUB -- hold until publication | | Title: | De novo designed enzyme for the Morita-Baylis-Hillman reaction (MBH61) | | Authors: | Tripp, A., Bijelic, A., Fischer, C., Moser, M., Oberdorfer, G. | | Deposition date: | 2025-05-14 |
|
| PDBID: | 9om5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Composite map of six VRC35 Fabs and three MEDI8852 Fabs bound to influenza H3N2 Victoria 2011 hemagglutinin | | Authors: | Cheng, J., Cale, E.M., Longo, N., Sutton, M.S., Lei, H., Huang, R., Morton, A.J., Lang, Z.C., Morano, N.C., Roark, R.S., Becker, J.E., Tsybovsky, Y., Li, N., Zhang, B., Du, H., Rubin, S., Shapiro, L., Pierson, T.C., Doria-Rose, N.A., Kwong, P.D., Zhou, T. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9om1 | | Status: | HPUB -- hold until publication | | Title: | Full length LRRK2 active form 1 (class6) | | Authors: | Villagran-Suarez, A.C. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9om2 | | Status: | HPUB -- hold until publication | | Title: | Full-length LRRK2 autoinhibited | | Authors: | Villagran-Suarez, A.C. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPARgamma in complex with the bisphenol derivative BPS4BE | | Authors: | Carivenc, C., Bourguet, W. | | Deposition date: | 2025-05-12 | | Sequence: | >Entity 1
GSHMQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
|
|
| PDBID: | 9r6k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPARgamma in complex with the bisphenol derivative BPPH | | Authors: | Carivenc, C., Bourguet, W. | | Deposition date: | 2025-05-12 | | Sequence: | >Entity 1
GSHMQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
|
|
