| PDBID: | 9szz | | Status: | HPUB -- hold until publication | | Title: | p53-Y220C Core Domain Covalently Bound to a Vinyl-Sulfone Fragment | | Authors: | Stahlecker, J., Stehle, T., Boeckler, F.M. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9szx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with 3C9 | | Authors: | Scarin, R., Rojas, A.L., Millet, O. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9t0c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Atg2-Atg18 complex from yeast | | Authors: | Chumpen Ramirez, S., Shvarev, D., Vargas Duarte, P., Milach, J., Lang, E., Kuchenbuch, S., Reggiori, F., Moeller, A., Ungermann, C. | | Deposition date: | 2025-10-16 |
|
| PDBID: | 9x6n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Klebsiella oxytoca ribitol dehydrogenase in complex with D-allulose | | Authors: | Yoshida, H., Yoshihara, A. | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9x6o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Klebsiella oxytoca ribitol dehydrogenase in complex with NAD+ | | Authors: | Yoshida, H., Yoshihara, A. | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9x67 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the type I pilus from Escherichia Coli and the surrounding water network | | Authors: | Petrova, T.E., Glukhov, A.S., Stetsenko, A., Guskov, A., Gabdulkhakov, A.G. | | Deposition date: | 2025-10-15 | | Sequence: | >Entity 1
AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ
|
|
| PDBID: | 9x6s | | Status: | HPUB -- hold until publication | | Title: | Structure of Influenza Hemagglutinin (A/Puerto Rico/8/1934) | | Authors: | Chen, Y., Li, S. | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9yq4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Chlorella virus hyaluronan synthase bound to a proofreading UDP-GlcA | | Authors: | Stephens, Z., Zimmer, J. | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9szo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the catalytic domain of USP7 in complex with Compound 13 | | Authors: | Chrzanowski, J., Wilk, P., Grudnik, P., Nowicka, J., Koralewski, R., Joachimiak, L., Gzik, A., Borek, B., Brzezinska, J., Blaszczyk, R. | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9szp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the human YTHDC2 YTH domain in complex with m6A DNA | | Authors: | Bedi, R.K., Caflisch, A. | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9szm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human fumarylacetoacetate hydrolase (FAH) in complex with 3C10 | | Authors: | Scarin, R., Rojas, A.L., Millet, O. | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9szn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the catalytic domain of USP7 in complex with Compound 43 | | Authors: | Chrzanowski, J., Wilk, P., Grudnik, P., Nowicka, J., Koralewski, R., Joachimiak, L., Gzik, A., Borek, B., Brzezinska, J., Blaszczyk, R. | | Deposition date: | 2025-10-15 |
|
| PDBID: | 9ypg | | Status: | PROC -- to be processed | | Title: | GTPBP1*GCP*Phe-tRNA*ribosome in the GTPase activation-like state, Structure III | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9ypx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Hepatitis C virus envelope glycoprotein E2ecto from genotype 1a bound to neutralizing antibody K415 and HEPC46 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9ypo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | GTPBP1*GCP*Phe-tRNA*ribosome in the open state, Structure IIa | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9yps | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | GTPBP1*GCP*Phe-tRNA*ribosome in the open state, Structure IIb | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9ypw | | Status: | PROC -- to be processed | | Title: | GTPBP1*GDP*Phe-tRNA*ribosome in the post-GTP hydrolysis state, Structure IV | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9ypy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ribosome with accommodated A-site tRNA, Structure V | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9ypz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Vacant ribosome with P-site tRNA, substate 1, Structure Ia | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9yq0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Vacant ribosome with P-site tRNA, substate 2, Structure Ib | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9yq1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Vacant ribosome with P-site tRNA, substate 3, Structure Ic | | Authors: | Susorov, D., Korostelev, A.A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9sz5 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of bacteriophage T5 L-shaped tail fiber : fiber domain | | Authors: | d''Acapito, A., Linares, R., Breyton, C. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9sz1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the human METTL3-METTL14 in complex with COD_122 | | Authors: | Bedi, R.K., Caflisch, A. | | Deposition date: | 2025-10-14 |
|
| PDBID: | 9sz7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of MraZ in complex with 4 box promoter from Mycoplasma genitalium | | Authors: | Reverter, D., Sanchez-Alba, L., Durand, A. | | Deposition date: | 2025-10-14 | | Release date: | 2026-10-14 |
|
| PDBID: | 9sz2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the human METTL3-METTL14 in complex with COD_ME_01 | | Authors: | Bedi, R.K., Caflisch, A. | | Deposition date: | 2025-10-14 |
|
