| PDBID: | 9wcw | | Status: | HPUB -- hold until publication | | Title: | AMP-PNP bound E.coli CnoX-GroEL complex, state I | | Authors: | Kim, J., Roh, S.H. | | Deposition date: | 2025-08-18 |
|
| PDBID: | 9sdj | | Status: | HPUB -- hold until publication | | Title: | Complex of Ovine Serum Albumin with Hydrolyzed Ampicillin | | Authors: | Duszynski, K., Talaj, J.A., Bujacz, A., Bujacz, G. | | Deposition date: | 2025-08-14 |
|
| PDBID: | 9s9y | | Status: | HPUB -- hold until publication | | Title: | Structure of protein kinase CK2alpha in complex with AMPPNP crystallized in space group P43212 | | Authors: | Werner, C., Gast, A., Jose, J., Niefind, K. | | Deposition date: | 2025-08-07 |
|
| PDBID: | 9pxt | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of NapA, the periplasmic nitrate reductase from Campylobacter jejuni | | Authors: | Thach, T., Subramanian, R. | | Deposition date: | 2025-08-06 |
|
| PDBID: | 9s73 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Complex of Equine Serum Albumin with Ampicillin | | Authors: | Duszynski, K., Sekula, B., Bujacz, A., Bujacz, G. | | Deposition date: | 2025-08-02 |
|
| PDBID: | 9s4z | | Status: | HPUB -- hold until publication | | Title: | AcuB from Geobacillus stearothermophilus with AMP and ADP | | Authors: | Janetzky, M., Palm, G.J., Lammers, M. | | Deposition date: | 2025-07-28 | | Sequence: | >Entity 1
ALVEQAMKAPVITLRATNTIAEALQLLRHHRIRHLPVVDGEGRLLGLVTSQDLRDASPSIFHLHEHLEDLQKPVSTIMKTDLIVGHPLDFVEEVAALFYEHRIGCLPIVNHGKLVGIITQTDLLRTFIELTGVHQPGSQIEIKVPNEAGMLSKAAAIISERHVNIASVLVYPAPDPNEKILVFRVQTMNPLPLIRDLQNAGYHVLWPNLPGVTSGSSHHHHHH
|
|
| PDBID: | 9s50 | | Status: | HPUB -- hold until publication | | Title: | AcuB from Geobacillus stearothermophilus with AMP and ATP | | Authors: | Janetzky, M., Palm, G.J., Lammers, M. | | Deposition date: | 2025-07-28 | | Sequence: | >Entity 1
ALVEQAMKAPVITLRATNTIAEALQLLRHHRIRHLPVVDGEGRLLGLVTSQDLRDASPSIFHLHEHLEDLQKPVSTIMKTDLIVGHPLDFVEEVAALFYEHRIGCLPIVNHGKLVGIITQTDLLRTFIELTGVHQPGSQIEIKVPNEAGMLSKAAAIISERHVNIASVLVYPAPDPNEKILVFRVQTMNPLPLIRDLQNAGYHVLWPNLPGVTSGSSHHHHHH
|
|
| PDBID: | 9s52 | | Status: | HPUB -- hold until publication | | Title: | AcuB from Geobacillus stearothermophilus with AMP | | Authors: | Janetzky, M., Palm, G.J., Lammers, M. | | Deposition date: | 2025-07-28 | | Sequence: | >Entity 1
ALVEQAMKAPVITLRATNTIAEALQLLRHHRIRHLPVVDGEGRLLGLVTSQDLRDASPSIFHLHEHLEDLQKPVSTIMKTDLIVGHPLDFVEEVAALFYEHRIGCLPIVNHGKLVGIITQTDLLRTFIELTGVHQPGSQIEIKVPNEAGMLSKAAAIISERHVNIASVLVYPAPDPNEKILVFRVQTMNPLPLIRDLQNAGYHVLWPNLPGVTSGSSHHHHHH
|
|
| PDBID: | 9s42 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Complex of Equine Serum Albumin with Hydrolyzed Ampicillin | | Authors: | Duszynski, K., Sekula, B., Bujacz, A., Bujacz, G. | | Deposition date: | 2025-07-25 |
|
| PDBID: | 9ple | | Status: | HPUB -- hold until publication | | Title: | Structure of Plasmodium falciparum cGMP-activated protein kinase bound to the ATP analogue AMPPNP | | Authors: | Metcalfe, R.D., Zhang, P. | | Deposition date: | 2025-07-15 |
|
| PDBID: | 9pjf | | Status: | HPUB -- hold until publication | | Title: | GII.4 Human Norovirus 3CL protease bound to compound 27 | | Authors: | Campbell, A.C., Opel-Reading, H.K., Krause, K.L. | | Deposition date: | 2025-07-14 |
|
| PDBID: | 9vse | | Status: | HPUB -- hold until publication | | Title: | Solution structure of BRCT domain of NAD+ dependent LigA from Mtb | | Authors: | Ampapathi, R.S., Vaishnav, J. | | Deposition date: | 2025-07-08 |
|
| PDBID: | 9rv7 | | Status: | HPUB -- hold until publication | | Title: | Streptococcus pneumoniae StkP catalytic domain T167A/T169A double mutant in complex with AMP-PNP and Mg2+ | | Authors: | Hamidi, M., Ravaud, S., Grangeasse, C. | | Deposition date: | 2025-07-07 |
|
| PDBID: | 9ruh | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the LB_DQB0602_B Fab - HLA-DQB1*06:02/DQA1*01:02 human alloantibody-HLA complex | | Authors: | Zampieri, V., Priddey, A., Kosmoliaptsis, V., Marquez, J.A. | | Deposition date: | 2025-07-04 |
|
| PDBID: | 9rug | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the LB_DQB0303_A Fab - HLA-DQB1*03:03/DQA1*02:01 human alloantibody-HLA complex | | Authors: | Zampieri, V., Priddey, A., Linares, R., Kosmoliaptsis, V., Marquez, J.A. | | Deposition date: | 2025-07-04 |
|
| PDBID: | 9ruf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the LB_DQB0301_A Fab - HLA-DQB1*03:01/DQA1*05:02 human alloantibody-HLA complex | | Authors: | Zampieri, V., Priddey, A., Kosmoliaptsis, V., Marquez, J.A. | | Deposition date: | 2025-07-04 |
|
| PDBID: | 9ruk | | Status: | HPUB -- hold until publication | | Title: | Streptococcus pneumoniae StkP catalytic domain T167A/T169A double mutant in complex with AMP-PNP and Mn2+ | | Authors: | Hamidi, M., Ravaud, S., Grangeasse, C. | | Deposition date: | 2025-07-04 |
|
| PDBID: | 9ruj | | Status: | HPUB -- hold until publication | | Title: | Streptococcus pneumoniae StkP catalytic domain T167E/T169E double mutant in complex with AMP-PNP and Mn2+ | | Authors: | Hamidi, M., Ravaud, S., Grangeasse, C. | | Deposition date: | 2025-07-04 |
|
| PDBID: | 9vmg | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the spermine-bound sea lamprey TAAR348-Gs complex | | Authors: | Jiang, K.X., Zheng, Y., Xu, F. | | Deposition date: | 2025-06-27 |
|
| PDBID: | 9p4g | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of Flagellar Assembly Protein FliW from Campylobacter jejuni subsp. jejuni 81-176-DRH212 | | Authors: | Minasov, G., Shuvalova, L., Wawrzak, Z., Kiryukhina, O., Satchell, K.J.F., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-06-16 | | Release date: | 2026-06-16 |
|
| PDBID: | 9p1q | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ube2E3 | | Authors: | Cook, M.W., Brzovic, P.S., Stenkamp, R.E. | | Deposition date: | 2025-06-10 | | Sequence: | >Entity 1
MTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
|
|
| PDBID: | 9vd1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Dimeric Suv3-ssRNA-AMPPNP complex | | Authors: | Patra, M., Yuan, H.S. | | Deposition date: | 2025-06-07 |
|
| PDBID: | 9vd0 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of monomeric Suv3-ssRNA-AMPPNP complex | | Authors: | Patra, M., Yuan, H.S. | | Deposition date: | 2025-06-07 |
|
| PDBID: | 9oyi | | Status: | HPUB -- hold until publication | | Title: | Structure of the E. coli clamp loader DnaX-complex loading beta-clamp onto 10-nt gapped DNA in state 2 conformer 1 with fully open clamp and unsettled DNA | | Authors: | Zheng, F., Yao, Y.N., Georgescu, R., Lyu, M., O''Donnell, M.E., Li, H. | | Deposition date: | 2025-06-04 |
|
| PDBID: | 9rcv | | Status: | HPUB -- hold until publication | | Title: | Structure of the Human Peptide-Loading Complex Arrested by HCMV US6 | | Authors: | Stolz, M., Susac, L., Trowitzsch, S., Tampe, R. | | Deposition date: | 2025-05-29 |
|
