| PDBID: | 7i27 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0018402-002 (A71EV2A-x2458) | | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 7i26 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0030304-001 (A71EV2A-x2304) | | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 9qbm | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of the drug binding domain of AlbA in complex with the KMR-04-177 compound of the pyrrolobenzodiazepines class | | Authors: | Di Palma, M., Steiner, R.A. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 9qbv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of WRN in complex with (R)-11 (GSK4766470) | | Authors: | Chaikuad, A., Concha, N., Chun, C.-W. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 9qbu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of WRN in complex with (S)-27 (GSK5819992) | | Authors: | Chaikuad, A., Chun, C.-W. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 9nl1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Fab MAM01 in complex with junctional region peptide from circumsporozoite protein | | Authors: | Jain, M., Wilson, I.A. | | Deposition date: | 2025-03-02 |
|
| PDBID: | 9nl0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Fab MAM01 in complex with NPNA3 peptide from circumsporozoite protein | | Authors: | Jain, M., Wilson, I.A. | | Deposition date: | 2025-03-02 |
|
| PDBID: | 9nkz | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Fab MAM01 in complex with NANP6 peptide from circumsporozoite protein | | Authors: | Jain, M., Wilson, I.A. | | Deposition date: | 2025-03-02 |
|
| PDBID: | 9nla | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [CC-5x_Ag6] Tensegrity triangle structure with a C:C base pair hosting a templated 6-atom silver nanocluster | | Authors: | Vecchioni, S., Perren, L., Sha, R., Ohayon, Y.P. | | Deposition date: | 2025-03-02 |
|
| PDBID: | 9nky | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of unliganded Fab MAM01 | | Authors: | Jain, M., Wilson, I.A. | | Deposition date: | 2025-03-02 |
|
| PDBID: | 9qbd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Brachyspira hampsonii PadR with Leu88 replaced by 3-aminotyrosine | | Authors: | Thunnissen, A.M.W.H., Brouwer, B., Roelfes, G. | | Deposition date: | 2025-03-02 |
|
| PDBID: | 9qbc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Brachyspira hampsonii PadR | | Authors: | Thunnissen, A.M.W.H., Rozeboom, H.J., Brouwer, B., Roelfes, G. | | Deposition date: | 2025-03-02 |
|
| PDBID: | 9nkx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [TT-5x_Ag4] Tensegrity triangle structure with a T:T base pair hosting a templated 4-atom silver nanocluster | | Authors: | Vecchioni, S., Perren, L., Sha, R., Ohayon, Y.P. | | Deposition date: | 2025-03-01 |
|
| PDBID: | 9nkv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [CC-5x_Ag4] Tensegrity triangle structure with a C:C base pair hosting a templated 4-atom silver nanocluster | | Authors: | Vecchioni, S., Perren, L., Sha, R., Ohayon, Y.P. | | Deposition date: | 2025-03-01 |
|
| PDBID: | 9nkw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [UU-5x_Ag4] Tensegrity triangle structure with a U:U base pair hosting a templated 4-atom silver nanocluster | | Authors: | Vecchioni, S., Perren, L., Sha, R., Ohayon, Y.P. | | Deposition date: | 2025-03-01 |
|
| PDBID: | 9qb9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with a heparin-derived trisaccharide and the ATP-competitive inhibitor 4w | | Authors: | Werner, C., Harasimowicz, H., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-03-01 |
|
| PDBID: | 9qal | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of Arkadia 2 RING domain | | Authors: | Marousis, K.D., Giannari, D., Seliami, A., Politi, M., Birkou, M., Bentrop, D., Episkopou, V., Spyroulias, G.A. | | Deposition date: | 2025-02-28 |
|
| PDBID: | 9m2l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of okaE in complex with a-ketoglutarate and okaramine A at 2.5 angstroms resolution. | | Authors: | Liu, T.H., Yan, W.P. | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9m1x | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of human heart fatty acid-binding protein at 0.80 A resolution (holo-FABP3) | | Authors: | Sugiyama, S., Maekawa, S., Matsuoka, S., Murata, M. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nin | | Status: | HPUB -- hold until publication | | Title: | The structure of human Vacuolar Protein Sorting 34 catalytic domain bound to RD-I-86 | | Authors: | Cartwright, J.J., Abiodun, W.O., Dass, R., Singleton, J.D., Doukov, T., Peterson, M.A., Moody, J.D. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nj4 | | Status: | HPUB -- hold until publication | | Title: | Fab1437 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9niw | | Status: | HPUB -- hold until publication | | Title: | Fab1550 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9niy | | Status: | HPUB -- hold until publication | | Title: | Fab1393 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9t | | Status: | HPUB -- hold until publication | | Title: | Human ROCK2 in complex with a dihydropyrazolo-pyrimidine inhibitor | | Authors: | Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C. | | Deposition date: | 2025-02-26 | | Sequence: | >Entity 1
GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
| PDBID: | 9m0m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a thermophilic family II inorganic pyrophosphatase in Thermodesulfobacterium commune | | Authors: | Maruoka, S., Teramoto, T., Watanabe, K., Kakuta, Y. | | Deposition date: | 2025-02-25 |
|
