PDBID: | 9h8y | Status: | HPUB -- hold until publication | Title: | Crystal Structure of alpha-crustacyanin from Homarus americanus | Authors: | Cianci, M., Cedri, M.C., Amici, A., Collet, T., McCarthy, A., Mueller-Dieckmann, C. | Deposition date: | 2024-10-29 | Sequence: | >Entity 1 DKIPDFVVPGKCASVDRNKLWAEQTPNRNNYAGVWYQFALTNNPYQLIEKCVRNEYSFDGEQFVITSTGIAYDGNLLKRNGKLYPNPFGEPHLSIDYENSFAAPLVILETDYSNYACLYSCIDYNFGYHSDFSFIFSRSANLADQYVKKCEAAFKNINVDTTRFVKTVQGSSCPYDTQKTL
>Entity 2 DGIPSFVTAGKCASVANQDNFDLRRYAGRWYQTHIIENAYQPVTRCINSNYEYSGNDYGFKVTTAGFNPNDEYLKIDFKVYPTKEFPAAHMLIDAPSVFAAPYEVIETDYETYSCVYSCITTDNYKSEFAFVFSRTPQTSGPAVEKCAAVFNKNGVEFSKFVPVSHTAECVYRA
>Entity 3 LNLPSSFHEEGSPISPESATAHVLPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAHVLPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAHVLPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAHVLPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAHVLPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAHVLPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAHVLPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAHVLPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAQALPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAHVLPTAYQKVDLDSEVLNLPSSFHEEGSPISPESATAHVLPTAYQKVD
|
|
PDBID: | 9h8r | Status: | HPUB -- hold until publication | Title: | Crystal structure of Nkp46 in complex with a bicyclic peptide BCY00016132 | Authors: | Pellegrino, S., Carr, K., Bezerra, G.A. | Deposition date: | 2024-10-29 |
|
PDBID: | 9h95 | Status: | HPUB -- hold until publication | Title: | YnaI in closed conformation purified in DDM with additional lipids showing ligand-filled pockets | Authors: | Flegler, V.J., Bottcher, B., Rasmussen, T., Rasmussen, A., Hedrich, R. | Deposition date: | 2024-10-29 |
|
PDBID: | 9h8g | Status: | HPUB -- hold until publication | Title: | Complex 5 30S-GE81112 | Authors: | Schedlbauer, A., Han, X., van Bakel, W., Kaminishi, T., Ochoa-Lizarralde, B., Iturrioz, I., Capuni, R., Parry, R., Zegarra, R., Gil-Carton, D., Lopez-Alonso, J.P., Barragan Sanz, K., Brandi, L., Gualerzi, C.O., Fucini, P., Connell, S.R. | Deposition date: | 2024-10-29 |
|
PDBID: | 9h8x | Status: | AUTH -- processed, waiting for author review and approval | Title: | Composite map for cryo-EM structure of alpha-crustacyanin from Homarus americanus | Authors: | Cedri, M.C., Cianci, M., Bansia, H., Amici, A., Wang, T., des Georges, A. | Deposition date: | 2024-10-29 |
|
PDBID: | 9kaw | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of SARS-CoV-2 PT Spike Protein complex with a potent broad-spectrum macrocyclic peptide inhibitor 6L3-3P11K | Authors: | Wang, M., Yang, J.Y., Peng, Q., Shi, Y. | Deposition date: | 2024-10-29 |
|
PDBID: | 9kal | Status: | HPUB -- hold until publication | Title: | The cryo-EM structure of Ac-E57A_G51DA53T a-syn fibril. | Authors: | Zhao, Q.Y., Tao, Y.Q., Li, D., Liu, C. | Deposition date: | 2024-10-29 |
|
PDBID: | 9kaq | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Human Peroxiredoxin I in complex with Salvianolic Acid A | Authors: | Zhang, H., Xu, H., Luo, C. | Deposition date: | 2024-10-29 |
|
PDBID: | 9e6e | Status: | HPUB -- hold until publication | Title: | Yeast Fzf1 Zn-fingers 1-3 bound to YHB1 26 bp DNA | Authors: | Moore, S.A., Ma, C., Xiao, W. | Deposition date: | 2024-10-29 |
|
PDBID: | 9h81 | Status: | HPUB -- hold until publication | Title: | human carbonic anhydrase I in complex with Sonepiprazole | Authors: | Angeli, A., Ferraroni, M. | Deposition date: | 2024-10-28 | Sequence: | >Entity 1 MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
PDBID: | 9ka3 | Status: | HPUB -- hold until publication | Title: | The cryo-EM structure of Ac-K58D_G51DA53T a-syn fibril. | Authors: | Zhao, Q.Y., Tao, Y.Q., Li, D., Liu, C. | Deposition date: | 2024-10-28 |
|
PDBID: | 9kaf | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the SPS3-FBN5 complex in a 2:1 state | Authors: | Xiao, H., Wang, Y.-W., Zhu, P., Yang, G.-F. | Deposition date: | 2024-10-28 |
|
PDBID: | 9kag | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the SPS3-FBN5 complex in a 2:2 state (class 4) | Authors: | Xiao, H., Wang, Y.-W., Zhu, P., Yang, G.-F. | Deposition date: | 2024-10-28 |
|
PDBID: | 9kah | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Chalcone Syntase and Chalcone Isomerase-like Protein Complex from Physcomitrella patens | Authors: | Imaizumi, R., Waki, T., Yasuda, A., Yanai, T., Takeshita, K., Sakai, N., Yamamoto, M., Nakayama, T., Yamashita, S. | Deposition date: | 2024-10-28 |
|
PDBID: | 9kai | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Chalcone Isomerase-like Protein from Physcomitrella patens | Authors: | Imaizumi, R., Waki, T., Yasuda, A., Yanai, T., Takeshita, K., Sakai, N., Yamamoto, M., Nakayama, T., Yamashita, S. | Deposition date: | 2024-10-28 |
|
PDBID: | 9kaj | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Chalcone Syntase from Physcomitrella patens complexed with Coenzyme A | Authors: | Imaizumi, R., Waki, T., Yasuda, A., Yanai, T., Takeshita, K., Sakai, N., Yamamoto, M., Nakayama, T., Yamashita, S. | Deposition date: | 2024-10-28 |
|
PDBID: | 9h7w | Status: | HPUB -- hold until publication | Title: | Hen Egg White Lysozyme in Complex with Imidizole | Authors: | Bauer, J.A., Bauerova, V. | Deposition date: | 2024-10-28 |
|
PDBID: | 9h7u | Status: | HPUB -- hold until publication | Title: | Hexagonally Ordered Nanofibrils Easily Yield by dual Amphiphilic Self-Assembling Peptide | Authors: | Mazzotta, F., Baptista, L.A., Schmidt, M., Gacanin, J., Lieberwirth, I., Weil, T., Landfester, K. | Deposition date: | 2024-10-28 |
|
PDBID: | 9h84 | Status: | HPUB -- hold until publication | Title: | BAM-hinge (LVPR) | Authors: | Machin, J.M., Ranson, N.A. | Deposition date: | 2024-10-28 |
|
PDBID: | 9h7z | Status: | HPUB -- hold until publication | Title: | Aspergillus niger Glucose Oxidase bound to Ba2+ ions | Authors: | Bauer, J.A., Bauerova, V. | Deposition date: | 2024-10-28 |
|
PDBID: | 9e54 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in complex with cyclic peptide L2 | Authors: | Nguyen, T.K.Y., Wilson, I.A. | Deposition date: | 2024-10-27 |
|
PDBID: | 9e55 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the A/Viet Nam/1203/2004(H5N1) influenza virus hemagglutinin in complex with cyclic peptide iHA-100 | Authors: | Nguyen, T.K.Y., Wilson, I.A. | Deposition date: | 2024-10-27 |
|
PDBID: | 9e53 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in complex with cyclic peptide iHA-100 | Authors: | Nguyen, T.K.Y., Wilson, I.A. | Deposition date: | 2024-10-27 |
|
PDBID: | 9h79 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Thrombin in complex with a Chlorothiophene-based inhibitor, CP2, discovered by a novel rapid nanoscale library screening. | Authors: | Chinellato, M., Zsolt, B., Angelini, A., Heinis, C., Cendron, L. | Deposition date: | 2024-10-27 |
|
PDBID: | 9k96 | Status: | HPUB -- hold until publication | Title: | Structure of Aurora A (122-403) bound to X5 | Authors: | Zhang, Z.M., Huang, H.S. | Deposition date: | 2024-10-25 |
|