| PDBID: | 9qlj | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of a Disordered Apo-form of A. Fischeri FNR | | Authors: | Volbeda, A., Fontecilla-Camps, J.C., Rohac, R. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvg | | Status: | HPUB -- hold until publication | | Title: | Structure of SARS-CoV-2 BA.1 spike RBD bound to COV2-3835 Fab | | Authors: | Ramamohan, A.R., Johnson, N.V., McLellan, J.S. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nvm | | Status: | HPUB -- hold until publication | | Title: | ATPase Hybrid F1 with the ancestral core domains Catalytic Dwell | | Authors: | Stewart, A.G., Noji, H., Sobti, M., Suzuki, A.K. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nvb | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of human SMYD1 in complex with MYH2 peptide and SAH | | Authors: | Zeng, H., Dong, A., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qld | | Status: | HPUB -- hold until publication | | Title: | Rhombohedral crystalline form of human insulin complexed with m-nitrophenol | | Authors: | Papaefthymiou, C., Nanao, M.H., Margiolaki, I., Kontarinis, A., Kafetzi, S., Konstantopoulos, M., Koutoulas, D. | | Deposition date: | 2025-03-20 | | Sequence: | >Entity 1
GIVEQCCTSICSLYQLENYCN
>Entity 2
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
| PDBID: | 9nui | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 1b from merged particles | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nuj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 1c from merged particles | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nul | | Status: | HPUB -- hold until publication | | Title: | SsoPfMCM:DNA class 2b from merged particles | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9num | | Status: | HPUB -- hold until publication | | Title: | SsoPfMCM:DNA class 3 from merged particles | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nun | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 1a from DNA 1 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nuo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 1b from DNA 1 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nup | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 1c from DNA 1 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nuq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 2a from DNA 1 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nur | | Status: | HPUB -- hold until publication | | Title: | SsoPfMCM:DNA class 2b from DNA 1 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nuv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 1c from DNA 2 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nuw | | Status: | HPUB -- hold until publication | | Title: | SsoPfMCM:DNA class 2a from DNA 2 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nux | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 2b from DNA 2 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nuy | | Status: | HPUB -- hold until publication | | Title: | SsoPfMCM:DNA class 3 from DNA 2 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nuk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 2a from merged particles | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nus | | Status: | HPUB -- hold until publication | | Title: | SsoPfMCM:DNA class 3 from DNA 1 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nut | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 1a from DNA 2 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nuu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 1b from DNA 2 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9u3i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a phenylalanine-modifi ed thrombin-binding DNA aptamer | | Authors: | Park, S., Kanazawa, H., Kondo, J. | | Deposition date: | 2025-03-18 |
|
| PDBID: | 9ntp | | Status: | HPUB -- hold until publication | | Title: | EGFR kinase domain (T790MV948R) in complex with a strain-release covalent inhibitor | | Authors: | Schonbrunn, E., Sun, L. | | Deposition date: | 2025-03-18 |
|
| PDBID: | 9u33 | | Status: | HPUB -- hold until publication | | Title: | D14.F25.S02 Fab complexed to DENV2-US/BID/V594/2006 virus - 5f-3f Fab map | | Authors: | Chatterjee, A.C., Mangala Prasad, V. | | Deposition date: | 2025-03-18 |
|
