| PDBID: | 9vzq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of RORgamma in complex with novel inverse agonist | | Authors: | Chen, S.M., Tian, S.Y., Li, Y. | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9vzr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | MG8, a PET hydrolase enzyme from the human saliva metagenome | | Authors: | Amornloetwattana, R., Meesawat, P., Robinson, C.R., Uttamapinant, C. | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9vzy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9w00 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9vzv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9vzu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9vzs | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9vzt | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9vzx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9w01 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9w02 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9w03 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9w05 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9w04 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9vzz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9s34 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9s33 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of inhibitor-bound Helicobacter pylori urease | | Authors: | Chen, X., Luecke, H., Buitrago, A. | | Deposition date: | 2025-07-23 | | Release date: | 2026-07-23 |
|
| PDBID: | 9s30 | | Status: | HPUB -- hold until publication | | Title: | GnaT, N-acetyltransferase. | | Authors: | Garcia-Pino, A., Talavera Perez, A. | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9s32 | | Status: | HPUB -- hold until publication | | Title: | METTL3-METTL14 heterodimer bound to the SAM competitive small molecule inhibitor STM3480 | | Authors: | Pilka, E.S., Blackaby, W., Hardick, D., Thomas, B., Ridgill, M., Rotty, B., Rausch, O., Bubert, C. | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9s2y | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-23 | | Release date: | 2026-07-23 |
|
| PDBID: | 9s2z | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-23 | | Release date: | 2026-07-23 |
|
| PDBID: | 9s31 | | Status: | HPUB -- hold until publication | | Title: | METTL3-METTL14 heterodimer bound to the SAM competitive small molecule inhibitor STM2011 | | Authors: | Pilka, E.S., Blackaby, W., Hardick, D., Thomas, B., Ridgill, M., Rotty, B., Rausch, O., Shepherd, J. | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9s38 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of LGR4 with NB21 | | Authors: | Wang, L., Geng, Y. | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9s2x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human RAGE ectodomain in complex with murine S100A6 mutant Y84C | | Authors: | Demou, M., Yatime, L. | | Deposition date: | 2025-07-23 |
|
| PDBID: | 9s36 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Candida albicans Vrg4 bound to an inhibitory nanobody and GDP-Mannose. | | Authors: | Deme, J.C., Parker, J.L., Lea, S.M., Newstead, S. | | Deposition date: | 2025-07-23 | | Sequence: | >Entity 1
MDSKHSTSSSSSGSLATRISNSGPISIAAYCLSSILMTVTNKYVLSGFSFNLNFFLLAVQSIVCIVTIGSLKSLNIITYRQFNKDEAKKWSPIAFLLVAMIYTSSKALQYLSIPVYTIFKNLTIILIAYGEVIWFGGKVTTMALSSFLLMVLSSVIAYYGDNAAVKSHDDAFALYLGYFWMLTNCFASAAFVLIMRKRIKLTNFKDFDTMYYNNLLSIPILLICSFIFEDWSSANVSLNFPADNRVTTITAMILSGASSVGISYCSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFEAAVNFWSVSSIFVGFGAGLVYAVAKQKQQKEQSQQLPTTK
>Entity 2
QVQLVESGGGLVQAGGSLRLSCAASGRTFRSYTLGWFRQAPGKEREFVAAIKWSTDTTYYADSVKGRFTISGDNAKNTVYLQMNSLKPEDTAVYFCAARSLSTVIAGPEIPWPYNSWGQGTQVTVSS
|
|
