| PDBID: | 9kia | | Status: | HOLD -- hold until a certain date | | Title: | Zn- Carbonic Anhydrase II pH 7.8 7.0 atm CO2 | | Authors: | Kim, C.U., Kim, J.K. | | Deposition date: | 2024-11-11 | | Release date: | 2026-05-11 |
|
| PDBID: | 9kir | | Status: | HOLD -- hold until a certain date | | Title: | Ni- Carbonic Anhydrase II pH 7.8 1.5 atm CO2 | | Authors: | Kim, C.U., Kim, J.K. | | Deposition date: | 2024-11-11 | | Release date: | 2026-05-11 |
|
| PDBID: | 9kis | | Status: | HOLD -- hold until a certain date | | Title: | Ni- Carbonic Anhydrase II pH 7.8 2.5 atm CO2 | | Authors: | Kim, C.U., Kim, J.K. | | Deposition date: | 2024-11-11 | | Release date: | 2026-05-11 |
|
| PDBID: | 9kit | | Status: | HOLD -- hold until a certain date | | Title: | Ni- Carbonic Anhydrase II pH 7.8 5.0 atm CO2 | | Authors: | Kim, C.U., Kim, J.K. | | Deposition date: | 2024-11-11 | | Release date: | 2026-05-11 |
|
| PDBID: | 9ki9 | | Status: | HOLD -- hold until a certain date | | Title: | Zn- Carbonic Anhydrase II pH 7.8 5.0 atm CO2 | | Authors: | Kim, C.U., Kim, J.K. | | Deposition date: | 2024-11-11 | | Release date: | 2026-05-11 |
|
| PDBID: | 7hon | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal Structure of ZIKV NS2B-NS3 protease in complex with ASAP-0014550-001 | | Authors: | Ni, X., Marples, P.G., Godoy, A.S., Koekemoer, L., Aschenbrenner, J.C., Balcomb, B.H., Fairhead, M., Lithgo, R.M., Lee, A., Kenton, N., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Williams, E.P., Chandran, A.V., Walsh, M.A., Fearon, D., von Delft, F. | | Deposition date: | 2024-11-07 |
|
| PDBID: | 9h9a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | native structure of the full-length pesticidal protein Cry8Ba2, from crystals formed in vivo (form 1) | | Authors: | Williamson, L.J., Best, H.L., Galchenkova, M., Rizkallah, P.J., Oberthur, D., Berry, C. | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9h9b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | native structure of the full-length pesticidal protein Cry8Ba2, from crystals formed in vivo (form 2) | | Authors: | Williamson, L.J., Best, H.L., Oberthur, D., Rizkallah, P.J., Berry, C. | | Deposition date: | 2024-10-30 |
|
| PDBID: | 9e47 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and (1-Hydroxypropan-2-yl)phosphonic acid | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C., Garneau-Tsodikova, S., Thamban Chandrika, N. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e43 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and Phosphonoacetate | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e44 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and 2-Phosphonopropionic acid | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e45 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and 1-Hydroxypropylphosphonic acid | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C., Garneau-Tsodikova, S., Thamban Chandrika, N. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9e46 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of FosA from Pseudomonas aeruginosa with Manganese and (1-Hydroxy-2-methylpropyl)phosphonic acid | | Authors: | Wiltsie, V., Thompson, M.K., Gilbert, N.C., Garneau-Tsodikova, S., Thamban Chandrika, N. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9dy6 | | Status: | HPUB -- hold until publication | | Title: | Structure of PmHMGR bound to mevalonate, CoA and NAD 4 minutes after reaction initiation at pH 9 | | Authors: | Purohit, V., Steussy, C.N., Schmidt, T., Stauffacher, C.V., Rushton, P. | | Deposition date: | 2024-10-13 | | Release date: | 2026-04-12 | | Sequence: | >Entity 1
MSLDSRLPAFRNLSPAARLDHIGQLLGLSHDDVSLLANAGALPMDIANGMIENVIGTFELPYAVASNFQINGRDVLVPLVVEEPSIVAAASYMAKLARANGGFTTSSSAPLMHAQVQIVGIQDPLNARLSLLRRKDEIIELANRKDQLLNSLGGGCRDIEVHTFADTPRGPMLVAHLIVDVRDAMGANTVNTMAEAVAPLMEAITGGQVRLRILSNLADLRLARAQVRITPQQLETAEFSGEAVIEGILDAYAFAAVDPYRAATHNKGIMNGIDPLIVATGNDWRAVEAGAHAYACRSGHYGSLTTWEKDNNGHLVGTLEMPMPVGLVGGATKTHPLAQLSLRILGVKTAQALAEIAVAVGLAQNLGAMRALATEGIQRGHMALHARNIAVVAGARGDEVDWVARQLVEYHDVRADRAVALLKQKRGQ
|
|
| PDBID: | 9h0t | | Status: | HPUB -- hold until publication | | Title: | N terminal domain of BC2L-C lectin (1-131) in complex with a beta-fucosylamide side-product | | Authors: | Antonin, G., Varrot, A. | | Deposition date: | 2024-10-09 | | Release date: | 2026-04-09 | | Sequence: | >Entity 1
GHMPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYASLSAIWGTAA
|
|
| PDBID: | 9h0u | | Status: | HPUB -- hold until publication | | Title: | N terminal domain of BC2L-C lectin (1-131) with covalent beta-fucosylamide ligand | | Authors: | Antonini, G., Varrot, A. | | Deposition date: | 2024-10-09 | | Release date: | 2026-04-09 | | Sequence: | >Entity 1
GHMPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILNVPTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVTFVKGQWKSVRGSAMHIDSYASLSAIWGTAA
|
|
| PDBID: | 9jvj | | Status: | HPUB -- hold until publication | | Title: | Structure of P450BytO mutant V219H in complex with pentapeptide MRYYH | | Authors: | Wang, H.Q., Xu, C., Ye, T., Xiang, Z. | | Deposition date: | 2024-10-09 | | Release date: | 2026-04-09 |
|
| PDBID: | 9ju3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | 3-fold Block-refine of Full particle of phiYY, a prokaryotic dsRNA virus | | Authors: | Meng, K.W., Cui, C.X., HuYan, Y.N., Zhang, X.Z., Meng, G. | | Deposition date: | 2024-10-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9dsg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the SARS-CoV-2 RBD in complex with the cow antibody P2 | | Authors: | Fan, C., Bjorkman, P.J. | | Deposition date: | 2024-09-27 | | Release date: | 2025-12-26 |
|
| PDBID: | 9dsj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the cow antibody 105 | | Authors: | Fan, C., Bjorkman, P.J. | | Deposition date: | 2024-09-27 | | Release date: | 2025-12-26 |
|
| PDBID: | 9dsk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the cow antibody 115 | | Authors: | Fan, C., Bjorkman, P.J. | | Deposition date: | 2024-09-27 | | Release date: | 2025-12-26 |
|
| PDBID: | 9dsh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the cow antibody P7 | | Authors: | Fan, C., Bjorkman, P.J. | | Deposition date: | 2024-09-27 | | Release date: | 2025-12-26 |
|
| PDBID: | 9dsi | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the cow antibody 99 | | Authors: | Fan, C., Bjorkman, P.J. | | Deposition date: | 2024-09-27 | | Release date: | 2025-12-26 |
|
| PDBID: | 9dpg | | Status: | HPUB -- hold until publication | | Title: | Structure of PmHMGR bound to mevalonate, CoA and NAD 2 minutes 20 seconds after reaction initiation at pH 9 | | Authors: | Purohit, V., Steussy, C.N., Schmidt, T., Stauffacher, C.V., Rushton, P. | | Deposition date: | 2024-09-21 | | Release date: | 2026-03-20 | | Sequence: | >Entity 1
MSLDSRLPAFRNLSPAARLDHIGQLLGLSHDDVSLLANAGALPMDIANGMIENVIGTFELPYAVASNFQINGRDVLVPLVVEEPSIVAAASYMAKLARANGGFTTSSSAPLMHAQVQIVGIQDPLNARLSLLRRKDEIIELANRKDQLLNSLGGGCRDIEVHTFADTPRGPMLVAHLIVDVRDAMGANTVNTMAEAVAPLMEAITGGQVRLRILSNLADLRLARAQVRITPQQLETAEFSGEAVIEGILDAYAFAAVDPYRAATHNKGIMNGIDPLIVATGNDWRAVEAGAHAYACRSGHYGSLTTWEKDNNGHLVGTLEMPMPVGLVGGATKTHPLAQLSLRILGVKTAQALAEIAVAVGLAQNLGAMRALATEGIQRGHMALHARNIAVVAGARGDEVDWVARQLVEYHDVRADRAVALLKQKRGQ
|
|
| PDBID: | 9dpd | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of SerRS dimer in complex with one SIRT2 | | Authors: | Yang, J., Zhang, Q., Lander, G.C., Yang, X. | | Deposition date: | 2024-09-21 |
|
