| PDBID: | 9md4 | | Status: | HPUB -- hold until publication | | Title: | Neuraminidase complexed with mAb 5-16 | | Authors: | Ferguson, J.A., Raghavan, S.S.R., Ward, A.B. | | Deposition date: | 2024-12-05 |
|
| PDBID: | 9md5 | | Status: | HPUB -- hold until publication | | Title: | Neuraminidase in complex with mAb 6-23.2 | | Authors: | Ferguson, J.A., Raghavan, S.S.R., Ward, A.B. | | Deposition date: | 2024-12-05 |
|
| PDBID: | 9md6 | | Status: | HPUB -- hold until publication | | Title: | Neuraminidase in complex with mAb 6-23.1 | | Authors: | Ferguson, J.A., Raghavan, S.S.R., Ward, A.B. | | Deposition date: | 2024-12-05 |
|
| PDBID: | 9hkt | | Status: | HPUB -- hold until publication | | Title: | Drosophila melanogaster insulin receptor ectodomain in complex with one DILP2 molecule | | Authors: | Shafi, T., Moroz, O.V., Jenkins, H.T., Chechik, M., Isupov, M.N., Brzozowski, A.M. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hl1 | | Status: | HPUB -- hold until publication | | Title: | DtpB in complex with photocaged nitric oxide, 10 ms, 10 microjoule, SFX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hle | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis SteB (Rv1698), a cell division regulator | | Authors: | Carloni, G., Wehenkel, A.M., Alzari, P.M. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hl9 | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF LEISHMANIA MAJOR 80S RIBOSOME WITH P/E-site tRNA AND mRNA : LM14Cs1H3 sKO STRAIN | | Authors: | Rajan, K.S., Yonath, A. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hku | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CREBBP histone acetyltransferase domain in complex with Acetyl-Coenzyme A | | Authors: | Mechaly, A.E., Zhang, W., Cui, G., Green, M.R., Rodrigues-Lima, F. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9elb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of glucocerebrosidase in complex with a covalent inhibitor | | Authors: | Pluvinage, B., Boraston, A.B. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9elr | | Status: | HPUB -- hold until publication | | Title: | env2 cobalamin riboswitch aptamer domain in complex with ethynyl-2-naphthalenepropiolate-cobalamin | | Authors: | Olenginski, L.T., Wolters, T.A., Batey, R.T. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9elc | | Status: | HPUB -- hold until publication | | Title: | Structure of glucocerebrosidase in complex with a covalent inhibitor | | Authors: | Pluvinage, B., Boraston, A.B. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hk6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IMPDH from Burkholderia thailandensis | | Authors: | Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hk7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IMPDH from Burkholderia thailandensis | | Authors: | Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hk9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IMPDH from Burkholderia thailandensis | | Authors: | Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hka | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IMPDH from Burkholderia thailandensis | | Authors: | Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hkb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IMPDH from Burkholderia thailandensis | | Authors: | Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hkc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IMPDH from Burkholderia thailandensis | | Authors: | Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hk8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IMPDH from Burkholderia thailandensis | | Authors: | Gelin, M., Labesse, G., Ayoub, N., Haouz, A., Munier-Lehmann, H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ku8 | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of P1 peptide bound with E. coli LPS | | Authors: | Mohid, S.A., Bhunia, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9eko | | Status: | HPUB -- hold until publication | | Title: | A chimeric hybrid protein fused with the FGFR3 Transmembrane Domain | | Authors: | Yu, Z., Kreitler, D.F., Gellman, S.H. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ekr | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) R136W in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ekp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of WDR55 in complex with XS381774 | | Authors: | Chen, U.H., Li, F., Zeng, H., Ahmad, H., Wang, X., Sun, J., Dong, A., Seitova, A., Arrowsmith, C.H., Edwards, A.M., Peng, H., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-12-03 | | Sequence: | >Entity 1
SMEAPTRIRDTPEDIVLEAPASGLAFHPARDLLAAGDVDGDVFVFSYSCQEGETKELWSSGHHLKACRAVAFSEDGQKLITVSKDKAIHVLDVEQGQLERRVSKAHGAPINSLLLVDENVLATGDDTGGIRLWDQRKEGPLMDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCMVPVTESLLCTGSTDGVIRAVNILPNRVVGSVGQHTGEPVEELALSHCGRFLASSGHDQRLKFWDMAQLRAVVVDD
|
|
| PDBID: | 9el2 | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) T151I in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9el3 | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) T164A in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ek9 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the mutant (R140Q) IDH2 homodimer | | Authors: | Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M. | | Deposition date: | 2024-12-02 |
|
