Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9gfw
Status:HPUB -- hold until publication
Title:HUMAN CARBONIC ANHYDRASE II IN COMPLEX WITH 4-methylphenyl-boronic acid at pH 7.4
Authors:Alterio, V., De Simone, G., Esposito, D.
Deposition date:2024-08-12
PDBID:9d32
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of the HKU5 RBD bound to the P. abramus ACE2 receptor
Authors:Park, Y.J., Seattle Structural Genomics Center for Infectious Disease (SSGCID), Veesler, D.
Deposition date:2024-08-09
PDBID:9d2x
Status:AUTH -- processed, waiting for author review and approval
Title:SpiD ETS-domain (168-273) in complex with the DNA sequence d(AATAAAAGGAAGTGGG)
Authors:Terrell, J.R., Vernon, T.N., Poon, G.M.K.
Deposition date:2024-08-09
PDBID:9gez
Status:HPUB -- hold until publication
Title:Crystal structure of thioredoxin reductase from Cryptosporidium parvum in the ""waiting"" position
Authors:Gabriele, F., Palerma, M., Ardini, M., Bogard, J., Chen, X.M., Williams, D.L., Angelucci, F.
Deposition date:2024-08-08
PDBID:9gf2
Status:HPUB -- hold until publication
Title:This peptide is a variant of the de novo hexameric peptide, CC-Hex2, which consists of 4 heptad repeats. This peptide has been denoted CC-Hex2 as its second heptad repeat has been replaced with a hendecad repeat.
Authors:Kurgan, K.W., Martin, F.J.O., Woolfson, D.N.
Deposition date:2024-08-08
PDBID:9gf4
Status:HPUB -- hold until publication
Title:This peptide is a variant of the previously designed de novo heptameric coiled-coil, CC-Hept-IV, which consists of 4 heptad repeats. We have denoted this de novo peptide CC-Hept-IV-hen2 as it includes a noncanonical, hendecad repeat which replaces the second heptad repeat in the original CC-Hept-IV sequence.
Authors:Kurgan, K.W., Martin, F.J.O., Woolfson, D.N.
Deposition date:2024-08-08
PDBID:9j3i
Status:AUTH -- processed, waiting for author review and approval
Title:Human TOM complex with Tom20 in cross-linking
Authors:Liu, D.S., Sui, S.F.
Deposition date:2024-08-08
PDBID:9d0g
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with O-cresomycin, mRNA, deacylated A-site tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.50A resolution
Authors:Aleksandrova, E.V., Wu, K.J.Y., Robinson, P.J., Benedetto, A.E., Yu, M., Tresco, B.I.C., See, D.N.Y., Jiang, T., Ramkissoon, A., Dunand, C.F., Svetlov, M.S., Lee, J., Myers, A.G., Polikanov, Y.S.
Deposition date:2024-08-07
PDBID:9d0h
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with C-cresomycin, mRNA, deacylated A-site tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.50A resolution
Authors:Aleksandrova, E.V., Wu, K.J.Y., Robinson, P.J., Benedetto, A.E., Yu, M., Tresco, B.I.C., See, D.N.Y., Jiang, T., Ramkissoon, A., Dunand, C.F., Svetlov, M.S., Lee, J., Myers, A.G., Polikanov, Y.S.
Deposition date:2024-08-07
PDBID:9d0i
Status:HPUB -- hold until publication
Title:Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Se-cresomycin, mRNA, deacylated A-site tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.45A resolution
Authors:Aleksandrova, E.V., Wu, K.J.Y., Robinson, P.J., Benedetto, A.E., Yu, M., Tresco, B.I.C., See, D.N.Y., Jiang, T., Ramkissoon, A., Dunand, C.F., Svetlov, M.S., Lee, J., Myers, A.G., Polikanov, Y.S.
Deposition date:2024-08-07
PDBID:9d0j
Status:HPUB -- hold until publication
Title:Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with BT-33, mRNA, deacylated A-site tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.50A resolution
Authors:Aleksandrova, E.V., Tresco, B.I.C., Wu, K.J.Y., Ramkissoon, A., Purdy, M., See, D.N.Y., Liu, R.Y., Myers, A.G., Polikanov, Y.S.
Deposition date:2024-08-07
PDBID:9d0v
Status:HOLD -- hold until a certain date
Title:Crystal structure of CDK2/CyclinE1 in complex with Cpd 2
Authors:Kwiatkowski, N., Liang, T., Sha, Z., Collier, P.N., Yang, A., Sathappa, M., Paul, A., Su, L., Zheng, X., Aversa, R., Li, K., Mehovic, R., Breitkopf, S.B., Chen, D., Howarth, C.L., Yuan, K., Jo, H., Growney, J.D., Weiss, M., Williams, J.
Deposition date:2024-08-07
Release date:2025-08-07
PDBID:9d0w
Status:HOLD -- hold until a certain date
Title:Cryo-EM structure of CDK2/CyclinE1 in complex with CRBN/DDB1 and Cpd 4
Authors:Kwiatkowski, N., Liang, T., Sha, Z., Collier, P.N., Yang, A., Sathappa, M., Paul, A., Su, L., Zheng, X., Aversa, R., Li, K., Mehovic, R., Breitkopf, S.B., Chen, D., Howarth, C.L., Yuan, K., Jo, H., Growney, J.D., Weiss, M., Williams, J.
Deposition date:2024-08-07
Release date:2025-08-07
PDBID:9d0x
Status:HOLD -- hold until a certain date
Title:Cryo-EM structure of CDK2/CyclinE1 in complex with CRBN/DDB1 and Cpd 4 (local mask)
Authors:Kwiatkowski, N., Liang, T., Sha, Z., Collier, P.N., Yang, A., Sathappa, M., Paul, A., Su, L., Zheng, X., Aversa, R., Li, K., Mehovic, R., Breitkopf, S.B., Chen, D., Howarth, C.L., Yuan, K., Jo, H., Growney, J.D., Weiss, M., Williams, J.
Deposition date:2024-08-07
Release date:2025-08-07
PDBID:9d0u
Status:HOLD -- hold until a certain date
Title:Crystal structure of CDK2 in complex with Cpd 2
Authors:Kwiatkowski, N., Liang, T., Sha, Z., Collier, P.N., Yang, A., Sathappa, M., Paul, A., Su, L., Zheng, X., Aversa, R., Li, K., Mehovic, R., Breitkopf, S.B., Chen, D., Howarth, C.L., Yuan, K., Jo, H., Growney, J.D., Weiss, M., Williams, J.
Deposition date:2024-08-07
Release date:2025-08-07
PDBID:9gdv
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Highly optimized CNS penetrant inhibitors of EGFR Exon20 Insertion Mutations
Authors:Hargreaves, D.
Deposition date:2024-08-06
PDBID:9j24
Status:AUTH -- processed, waiting for author review and approval
Title:Structural basis of the bifunctionality of M. salinexigens ZYF650T glucosylglycerol phosphorylase in glucosylglycerol catabolism
Authors:Lu, D., Ma, H.L.
Deposition date:2024-08-06
PDBID:9j25
Status:AUTH -- processed, waiting for author review and approval
Title:Structural basis of the bifunctionality of M. salinexigens ZYF650T glucosylglycerol phosphorylase in glucosylglycerol catabolism
Authors:Lu, D., Ma, H.L.
Deposition date:2024-08-06
PDBID:9gdg
Status:HPUB -- hold until publication
Title:Crystal structure of TRIM24 PHD-BRD in complex with N-(2-(2-(2-acetamidoethoxy)ethoxy)ethyl)-3-(N-(1,3-dimethyl-2-oxo-6-(3-propoxyphenoxy)-2,3-dihydro-1H-benzo[d]imidazol-5-yl)sulfamoyl)benzamide (PEG linker unresolved)
Authors:Platt, M.A., Kot, E., Conway, S.J., Koekemoer, L.
Deposition date:2024-08-05
PDBID:9gdi
Status:HPUB -- hold until publication
Title:HUMAN PI3KDELTA IN COMPLEX WITH ISOCUMARIN INHIBITOR 10
Authors:Pala, D., Bruno, P., Capelli, A.M., Biagetti, M.
Deposition date:2024-08-05
Sequence:

>Entity 1


MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFHMLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLLIGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSSSEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSVALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMRQEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGGSVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ

>Entity 2


YQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNETEIQRIMHNYEKLKSRISEIVDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
PDBID:9j1u
Status:AUTH -- processed, waiting for author review and approval
Title:Structural basis of the bifunctionality of M. salinexigens ZYF650T glucosylglycerol phosphorylase in glucosylglycerol catabolism
Authors:Lu, D., Ma, H.L.
Deposition date:2024-08-05
PDBID:9cze
Status:HPUB -- hold until publication
Title:High-Resolution Structure of Human DHODH for Molecular Replacement in Fragment Screening Campaign
Authors:Purificacao, A.D., Benz, L.S., Froes, T.Q., Weiss, M.S., Nonato, M.C.
Deposition date:2024-08-05
PDBID:9gcs
Status:HPUB -- hold until publication
Title:Rho-ATP-Psu complex II
Authors:Gjorgjevikj, D., Wahl, M.C., Hilal, T., Loll, B.
Deposition date:2024-08-02
PDBID:9gct
Status:HPUB -- hold until publication
Title:Rho-ATP-Psu complex II expanded
Authors:Gjorgjevikj, D., Wahl, M.C., Hilal, T., Loll, B.
Deposition date:2024-08-02
PDBID:9gcq
Status:HPUB -- hold until publication
Title:Human Butyrylcholinesterase in complex with N1,N1-dimethyl-N2-(6-(naphthalen-2-yl)-5-(pyridin-4-yl)pyridazin-3-yl)ethane-1,2-diamine
Authors:Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F.
Deposition date:2024-08-02

225399

数据于2024-09-25公开中

PDB statisticsPDBj update infoContact PDBjnumon