| PDBID: | 9ndd | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer, combined core plus aptamer | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifp | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Psathyrella aberdarensis (PabUPO-II) in complex with 2,6-dimethoxyphenol | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifq | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Psathyrella aberdarensis (PabUPO-II) in complex with 5-hydroxymethylfurfural | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ncs | | Status: | HPUB -- hold until publication | | Title: | RNase A in complex with Uridine Vanadate and decavanadates | | Authors: | Gutierrez, C.S., Lim, D.C., Silkenath, B., Kojasoy, V., Raines, R.T. | | Deposition date: | 2025-02-17 | | Sequence: | >Entity 1
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
|
|
| PDBID: | 9if1 | | Status: | HPUB -- hold until publication | | Title: | Unliganded structure of RNA duplex containing UGGAA/UGGAA motif | | Authors: | Mateja-Pluta, M., Kiliszek, A. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9if0 | | Status: | HPUB -- hold until publication | | Title: | RNA duplex containing UGGAA/UGGAA motif interacting with NCD molecule | | Authors: | Mateja-Pluta, M., Kiliszek, A. | | Deposition date: | 2025-02-15 |
|
| PDBID: | 9nb3 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of quaternary complex of human phosphoribosylglycinamidine synthase with thioester intermediate bound (at glutaminase site) and AMPPNP and FGAR (at synthase site). | | Authors: | Sharma, N., French, J.B. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nbc | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nbh | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer core only | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nal | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of ternary complex of human phosphoribosylglycinamidine synthase with the intermediate (iminophosphate) and ADP bound at the synthase site. | | Authors: | Sharma, N., French, J.B. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nak | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to tRNA | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nam | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to Mango in the absence of ligand | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nap | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to Mango in the presence of TO1-biotin | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nas | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to disordered U1A stem loop | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Salmonella typhimurium polynucleotide phosphorylase in complex with recognition site of RNase E | | Authors: | Paris, G., Luisi, B.F. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9na1 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na7 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iaj | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclodipeptide synthase from Nocardia brasiliensis (Nbra-CDPS) in complex with RNA microhelices mimicking tRNA-Ala acceptor arm | | Authors: | Marouf, F.Z., Charbonnier, J.B., Fernandez Varela, P. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iak | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclodipeptide synthase from Nocardia brasiliensis (Nbra-CDPS) in complex with RNA microhelices mimicking tRNA-Glu acceptor arm | | Authors: | Marouf, F.Z., Charbonnier, J.B., Fernandez Varela, P. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9ial | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclodipeptide synthase from Nocardia brasiliensis (Nbra-CDPS) in complex with RNA microhelices mimicking tRNA-Glu acceptor arm | | Authors: | Marouf, F.Z., Charbonnier, J.B., Fernandez Varela, P. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iam | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of cyclodipeptide synthase from Nocardia brasiliensis (Nbra-CDPS) in complex with alanylated RNA microhelices analogues mimicking Ala-tRNA-Ala substrate | | Authors: | Marouf, F.Z., Charbonnier, J.B., Fernandez Varela, P., Legrand, P. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n5y | | Status: | HPUB -- hold until publication | | Title: | Hemagglutinin CA09 homotrimer bound to AEL31302/AEL31311 Fab | | Authors: | Fernandez-Quintero, M.L., Turner, H.L. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n5c | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoG at +1 site, CMPCPP-bound | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n5d | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoG at +1 site, CMP added | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n5e | | Status: | HOLD -- hold until a certain date | | Title: | RNA polymerase II elongation complex with 8-oxoG at +1 site, AMPCPP in E-site | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2025-02-04 | | Release date: | 2026-02-04 |
|
