| PDBID: | 9okm | | Status: | AUCO -- author corrections pending review | | Title: | Solution Structure of the Garvicin Immunity Protein | | Authors: | Mallett, T.M., Lamer, T.D., Vederas, J.C. | | Deposition date: | 2025-05-10 |
|
| PDBID: | 9r5d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human protein kinase CK2 catalytic subunit (isoenzyme ck2alpha''; CSNK2A2 gene product) in complex with 4,6-dibromo-5,7-difluoro-1H-1,2,3-benzotriazole | | Authors: | Kasperowicz, S., Werner, C., Podsiadla-Bialoskorska, M., Szolajska, E., Lindenblatt, D., Niefind, K., Poznanski, J., Winiewska-Szajewska, M. | | Deposition date: | 2025-05-08 |
|
| PDBID: | 9r5c | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human protein kinase CK2 catalytic subunit (isoenzyme ck2alpha''; CSNK2A2 gene product) in complex with 4,7-dibromo-5,6-difluoro-1H-1,2,3-benzotriazole | | Authors: | Kasperowicz, S., Werner, C., Podsiadla-Bialoskorska, M., Szolajska, E., Lindenblatt, D., Niefind, K., Poznanski, J., Winiewska-Szajewska, M. | | Deposition date: | 2025-05-08 |
|
| PDBID: | 9r5f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human protein kinase CK2 catalytic subunit (isoenzyme ck2alpha''; CSNK2A2 gene product) in complex with 5,6-dibromo-4,7-difluoro-1H-1,2,3-benzotriazole | | Authors: | Kasperowicz, S., Werner, C., Podsiadla-Bialoskorska, M., Szolajska, E., Lindenblatt, D., Niefind, K., Poznanski, J., Winiewska-Szajewska, M. | | Deposition date: | 2025-05-08 |
|
| PDBID: | 9r5a | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an NtA622L variant in complex with NADP+ | | Authors: | Mokos, D., Daniel, B. | | Deposition date: | 2025-05-08 |
|
| PDBID: | 9r4j | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of MraZ in complex with its promoter from Mycoplasma genitalium | | Authors: | Reverter, D., Sanchez-Alba, L., Durand, A. | | Deposition date: | 2025-05-07 |
|
| PDBID: | 9oiu | | Status: | HPUB -- hold until publication | | Title: | Soltion Structure of His6-Small Ubiquitin-like Modifier (His6-SUMO) | | Authors: | Mallett, T.M., Lamer, T.D., Vederas, J.C. | | Deposition date: | 2025-05-06 | | Sequence: | >Entity 1
MGSSHHHHHHGSGLVPRGSASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
|
|
| PDBID: | 9ois | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glycosyltransferase family 61 from Sorghum bicolor | | Authors: | Pereira, J.H., Wang, H.T., DeGiovanni, A.M., Scheller, H.V., Adams, P.D. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9r3r | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF LYSYL-TRNA SYNTHETASE FROM Cryptosporidium parvum COMPLEXED WITH L-LYSINE AND INHIBITOR DDD01827593 | | Authors: | Dawson, A., Baragana, B., Forte, B., Robinson, D.A. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9ohn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human p97/VCP bound to inhibitor GND-135 | | Authors: | Crawford, J., Munuganti, R., Leung, C., Singh, K., Gates, E., Zhu, X., Bally, M., Dos Santos, N., Sharifiaghdam, M., Nosrati, Z., Axerio-Cilies, P., Berezuk, A., Cholak, S., Cameron, D., Subramaniam, S. | | Deposition date: | 2025-05-05 |
|
| PDBID: | 9r3j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human MAO B in complex with (E)-3-(benzo[d][1,3]dioxol-5-yl)-1-(3-(trifluoromethyl)phenyl)prop-2-en-1-one (chalcone inhibitor, 4e) | | Authors: | Marchese, S., Binda, C. | | Deposition date: | 2025-05-05 |
|
| PDBID: | 9r35 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the Pseudomonas putida Xre-RES toxin-antitoxin complex bound to promoter DNA | | Authors: | Henriksen, F.O.G., Brodersen, D.E. | | Deposition date: | 2025-05-02 |
|
| PDBID: | 9urz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the Prohibitin complex from Chaetomium thermophilum | | Authors: | Luo, D.Y., Zheng, L.Q., Lu, M.A., Chen, Z.Y., Wang, P.P., Guo, Q., Gao, N. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9ofr | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF THE HUMAN IGA1 FC FRAGMENT-FC-ALPHA RECEPTOR (CD89) COMPLEX | | Authors: | Korzeniowski, M., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9ofs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human IGA2m2 FC fragment-FC-alpha receptor (CD89) complex | | Authors: | Chandravanshi, M., Korzeniowski, M., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9og7 | | Status: | HPUB -- hold until publication | | Title: | APO SARS-COV-2-6P-MUT7 S PROTEIN 1 RBD UP CONFORMATION | | Authors: | Niu, L., Chandravanshi, M., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9og6 | | Status: | HPUB -- hold until publication | | Title: | Apo SARS-COV-2-6P-MUT7 S PROTEIN closed conformation | | Authors: | Niu, L., Chandravanshi, M., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9og5 | | Status: | HPUB -- hold until publication | | Title: | SARS-COV-2-6P-MUT7 S PROTEIN-DY-III-281 complex 1 RBD up conformation | | Authors: | Chandravanshi, M., Niu, L., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9og4 | | Status: | HPUB -- hold until publication | | Title: | SARS-COV-2-6P-MUT7 S PROTEIN-DY-III-281 complex closed conformation | | Authors: | Chandravanshi, M., Niu, L., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9r2n | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the complex CCNY:14-3-3 | | Authors: | Kosek, D., Kohoutova, K., Obsilova, V., Obsil, T. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9urf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of beta-glucosidase from Bacteroides ovatus | | Authors: | Kumar, A.K., Jamdar, S.N., Sarver, R., Makde, R.D. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9urg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of beta-glucosidase from Bacteroides ovatus bound to beta-D-Glucose | | Authors: | Kumar, A.K., Jamdar, S.N., Sarver, R., Makde, R.D. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9urd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Zinc-binding metallopeptidase (Uniprot: A0AAN3A8D2) from Bacteroides ovatus | | Authors: | Kulkarni, B.S., Kumar, A.K., Jamdar, S.N., Makde, R.D. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9of4 | | Status: | HPUB -- hold until publication | | Title: | Structure of the Acinetobacter baumannii Response Regulator PmrA Receiver Domain M12I Mutation | | Authors: | Jaimes, F.E., Milton, M.E., Hondros, A.D., Cavanagh, J. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9r2c | | Status: | HPUB -- hold until publication | | Title: | CpKRS in complex with inhibitor DDD01038762 | | Authors: | Dawson, A., Baragana, B., Robinson, D.A. | | Deposition date: | 2025-04-29 |
|
