| PDBID: | 9v2f | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | CTP synthase dDON-state 5 | | Authors: | Guo, C.J. | | Deposition date: | 2025-05-19 |
|
| PDBID: | 9onu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of a P-loop mutant PTP-like myo-inositol phosphatase from Selenomonas ruminantium in complex with myo-inositol-(1,2,4,5,6)-pentakisphosphate | | Authors: | Cleland, C.P., Mosimann, S.C. | | Deposition date: | 2025-05-15 | | Release date: | 2026-11-14 |
|
| PDBID: | 9r7w | | Status: | HPUB -- hold until publication | | Title: | 5-Helix Tile - Twist Corrected (5HT-TC) with 2''-Fluoro-modified pyrimidines (FY RNA) | | Authors: | Kristoffersen, E.L., Andersen, E.S., Zwergius, N.H. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9r6c | | Status: | HOLD -- hold until a certain date | | Title: | CPS secretion pathway Wza-Wzc (Conf 5) | | Authors: | Yuan, B., Heinz, D.W. | | Deposition date: | 2025-05-11 | | Release date: | 2026-05-11 |
|
| PDBID: | 9r5c | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human protein kinase CK2 catalytic subunit (isoenzyme ck2alpha''; CSNK2A2 gene product) in complex with 4,7-dibromo-5,6-difluoro-1H-1,2,3-benzotriazole | | Authors: | Kasperowicz, S., Werner, C., Podsiadla-Bialoskorska, M., Szolajska, E., Lindenblatt, D., Niefind, K., Poznanski, J., Winiewska-Szajewska, M. | | Deposition date: | 2025-05-08 |
|
| PDBID: | 9r5f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human protein kinase CK2 catalytic subunit (isoenzyme ck2alpha''; CSNK2A2 gene product) in complex with 5,6-dibromo-4,7-difluoro-1H-1,2,3-benzotriazole | | Authors: | Kasperowicz, S., Werner, C., Podsiadla-Bialoskorska, M., Szolajska, E., Lindenblatt, D., Niefind, K., Poznanski, J., Winiewska-Szajewska, M. | | Deposition date: | 2025-05-08 |
|
| PDBID: | 9r5d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human protein kinase CK2 catalytic subunit (isoenzyme ck2alpha''; CSNK2A2 gene product) in complex with 4,6-dibromo-5,7-difluoro-1H-1,2,3-benzotriazole | | Authors: | Kasperowicz, S., Werner, C., Podsiadla-Bialoskorska, M., Szolajska, E., Lindenblatt, D., Niefind, K., Poznanski, J., Winiewska-Szajewska, M. | | Deposition date: | 2025-05-08 |
|
| PDBID: | 9oje | | Status: | HPUB -- hold until publication | | Title: | Structure of Undecaprenyl diphosphate synthase (UPPS) from Neisseria gonorrohea soaked with 5-bromo picolinic acid | | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Barreiro, G., Massirer, K.B., Counago, R.M. | | Deposition date: | 2025-05-07 |
|
| PDBID: | 9r41 | | Status: | HPUB -- hold until publication | | Title: | Buspirone-bound serotonin 5-HT1A receptor - Gi Protein Complex | | Authors: | Schneider, J., Gmeiner, P., Boettcher, B. | | Deposition date: | 2025-05-07 |
|
| PDBID: | 9ocm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dihydroorotate dehydrogenase from Leishmania brasiliensis in complex with (E)-5-(3-(4-nitrophenyl)allylidene)pyrimidine-2,4,6(1H,3H,5H)-trione | | Authors: | Vaidergorn, M.M., Nonato, M.C., Froes, T.Q., Augusto, B.S. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9obb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dihydroorotate dehydrogenase from Leishmania brasiliensis in complex with 5-[(E)-3-(p-methoxyphenyl)-2-propenylidene]-2,4,6(1H,3H,5H)-pyrimidinetrione | | Authors: | Vaidergorn, M.M., Nonato, M.C., Froes, T.Q., Augusto, B.S. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9oax | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | TNA polymerase, 5-270, ternary complex | | Authors: | Lee, J.J., Maola, V.A., Chim, N., Chaput, J.C. | | Deposition date: | 2025-04-21 |
|
| PDBID: | 9oat | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | TNA polymerase, 5-270, binary complex | | Authors: | Lee, J.J., Maola, V.A., Barpuzary, B., Chim, N., Chaput, J.C. | | Deposition date: | 2025-04-21 |
|
| PDBID: | 9o75 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IgG1 I253M at pH 6.5 | | Authors: | Reddem, E.R., Shapiro, L. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qvu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepI-(1,5)-KdoI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-12 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9o64 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of IgG1 FC I253M at pH 5.5 | | Authors: | Reddem, E.R., Shapiro, L. | | Deposition date: | 2025-04-11 |
|
| PDBID: | 9o5g | | Status: | HPUB -- hold until publication | | Title: | Room-temperature joint X-ray/Neutron structure of Thermus thermophilus SHMT in complex with PLP-Gly external aldimine and 5-methyl-tetrahydrofolate (5MTHF) | | Authors: | Kovalevsky, A., Drago, V.N., Phillips, R.S. | | Deposition date: | 2025-04-10 | | Sequence: | >Entity 1
STLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTHKTLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPSEALREEVRRLALAHPMP
|
|
| PDBID: | 9uf2 | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 5 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9ubo | | Status: | HPUB -- hold until publication | | Title: | The structure of type III CRISPR-associated deaminase in complex cA6 and ATP, state 5 | | Authors: | Kong, J.P., Wu, W.Q., Li, Z.X., Xiao, Y.B. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9u8s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiamine pyrophosphate (TPP)-dependent alpha-imino acid decarboxylase (AzcB and AzcC) from Streptomyces mobaraensis in complex with TPP and 5-azacytosine. | | Authors: | Nakashima, Y., Tsunoda, T., Ogasawara, Y., Dairi, T., Morita, H. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8r | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiamine pyrophosphate (TPP)-dependent alpha-imino acid decarboxylase (AzcB and AzcC) from Streptomyces mobaraensis in complex with TTPP and 6-amino-4-oxo-4,5-dihydro-1,3,5-triazine-2-carboxylic acid. | | Authors: | Nakashima, Y., Tsunoda, T., Ogasawara, Y., Dairi, T., Morita, H. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qkb | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 5 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9m61 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of 5-HT2BR in complex with RS127445 | | Authors: | Zhong, Y.X., Guo, Q., Tao, Y.Y. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m60 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of 5-HT2BR in complex with ritanseirn | | Authors: | Zhong, Y.X., Guo, Q., Tao, Y.Y. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9qdg | | Status: | HOLD -- hold until a certain date | | Title: | Nitratidesulfovibrio vulgaris [FeFe] hydrogenase crystallized in the sodium propionate buffer at pH 5.0 | | Authors: | Bikbaev, K., Span, I. | | Deposition date: | 2025-03-06 | | Release date: | 2026-03-06 |
|
