| PDBID: | 9nyq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CDK2/CyclinE1 in complex with Cpd 3 | | Authors: | Collier, P., Zheng, X., Ford, M., Weiss, M., Aversa, R., Chen, D., Li, K., Growney, J.D., Yang, A., Sathappa, M., Breitkopf, S.B., Enerson, B., Sawant, R., Su, L., Howarth, L., Liang, T., Paul, A., Sharma, K., Williams, J., Kwiatkowski, N.P. | | Deposition date: | 2025-03-28 |
|
| PDBID: | 9nyr | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CDK2/CyclinE1 in complex with CRBN/DDB1 and Cpd 24 | | Authors: | Collier, P., Zheng, X., Ford, M., Weiss, M., Aversa, R., Chen, D., Li, K., Growney, J.D., Yang, A., Sathappa, M., Breitkopf, S.B., Enerson, B., Sawant, R., Su, L., Howarth, L., Liang, T., Paul, A., Sharma, K., Williams, J., Kwiatkowski, N.P. | | Deposition date: | 2025-03-28 |
|
| PDBID: | 9nys | | Status: | HPUB -- hold until publication | | Title: | Human DNA Ligase 1 E346A/E592A/K845N triple mutant with 3''-A:T nick | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2025-03-28 |
|
| PDBID: | 9qph | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and IPN using tr-SFX | | Authors: | Rabe, P., Schofield, C.J., Stead, A. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpi | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and ACV | | Authors: | Rabe, P., Schofield, C.J., Stead, A. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpj | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase in complex with Fe and IPN using tr-SSX | | Authors: | Rabe, P., Schofield, C.J., Stead, A. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpp | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of human MATa2 in complex with MAT2B isoform v1 at 2.6 A resolution | | Authors: | Khaja, F., Antonyuk, S.V., Muench, S.P., Hasnain, S.S. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpo | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of human MATa2 in complex with MATBv2 at 2.6 A resolution | | Authors: | Khaja, F., Antonyuk, S.V., Muench, S.P., Hasnain, S.S. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpd | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qpf | | Status: | HPUB -- hold until publication | | Title: | Solution structure of Sox2 DBD | | Authors: | Orsetti, A., van Ingen, H. | | Deposition date: | 2025-03-27 | | Sequence: | >Entity 1
GSNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTL
|
|
| PDBID: | 9qpk | | Status: | HPUB -- hold until publication | | Title: | E.coli TalB mutant E96Q, F178Y, R300E | | Authors: | Soderholm, A., Roos, A., Widersten, M. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nyg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | LmuABC-DNA | | Authors: | Chakravarti, A., Zhang, Z. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nyk | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the glycosyltransferase GtrB in the pre-intermediate state | | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nyc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the glycosyltransferase GtrB in the substrate-bound state | | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., Bhattacharjee, B., di Muccio, G., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nyd | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the glycosyltransferase GtrB in the pre-catalysis and product-bound state | | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nyf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the glycosyltransferase GtrB (tetramer volume) | | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nye | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the glycosyltransferase GtrB in the apo state (octamer volume) | | Authors: | Morgan, R.T., Motta, S., Gil-Iturbe, E., di Muccio, G., Bhattacharjee, B., Romagnoli, A., Anwar, M.T., Mishra, B., Ashraf, K., Bang, I., di Marino, D., Lowary, T.L., Quick, M., Petrou, V.I., Stowell, M.H.B., Nygaard, R., Mancia, F. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9nyj | | Status: | HPUB -- hold until publication | | Title: | MoaC-pyranopterin [(alpha-beta-methyleno]triphosphate covalent complex in the absence of Mg2+ | | Authors: | Schumacher, M.A., Yokoyama, K. | | Deposition date: | 2025-03-27 |
|
| PDBID: | 9qoh | | Status: | HPUB -- hold until publication | | Title: | Mouse Ribosome POST translocation state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qov | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of [2Fe-2S]b D4A-FNR of A. fischeri | | Authors: | Volbeda, A., Fontecilla-Camps, J.C., Rohac, R. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qp8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Diels Alderase Cyc15b | | Authors: | Yang, S., Kisa, D., Basle, A., Race, P.R. | | Deposition date: | 2025-03-26 | | Release date: | 2026-03-26 |
|
| PDBID: | 9qoe | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-Id with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qoc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qod | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRSIKIK
|
|
| PDBID: | 9qom | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRSIKIK
|
|
