| PDBID: | 9bhh | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Chikungunya virus asymmetric unit with Fab IM-CKV063 | | Authors: | Su, G.C., Galaz-Montoya, J.G., Pintilie, G., Jin, J., Chiu, W. | | Deposition date: | 2024-04-20 | | Release date: | 2025-10-19 |
|
| PDBID: | 9bh3 | | Status: | HPUB -- hold until publication | | Title: | Structure of apo Aggregatibacter actinomycetemcomitans SiaP protein | | Authors: | King-Hudson, T.-R.J., Davies, J.S., Dobson, R.C.J. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bdb | | Status: | HPUB -- hold until publication | | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | | Authors: | Schormann, N., Green, T., Turnbough, C.L. | | Deposition date: | 2024-04-11 | | Release date: | 2025-10-10 | | Sequence: | >Entity 1
MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2
AFDPNLVGPTLPPIPPFTL
|
|
| PDBID: | 9bda | | Status: | HPUB -- hold until publication | | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | | Authors: | Schormann, N., Green, T., Turnbough, C.L. | | Deposition date: | 2024-04-11 | | Release date: | 2025-10-10 | | Sequence: | >Entity 1
MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2
AFDPNLVGPTLPPIPPFTL
|
|
| PDBID: | 9exn | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | The vaccinia minimal RNA polymerase cryo EM structure at 1.9A resolution | | Authors: | Grimm, C., Jungwirth, S., Fischer, U. | | Deposition date: | 2024-04-08 |
|
| PDBID: | 9bbn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Chikungunya virus asymmetric unit with Fab C9 | | Authors: | Su, G.C., Galaz-Montoya, J.G., Pintilie, G., Jin, J., Chiu, W. | | Deposition date: | 2024-04-06 | | Release date: | 2025-10-05 |
|
| PDBID: | 9axw | | Status: | HOLD -- hold until a certain date | | Title: | Nanobody NbJRI bound to yeast Pdc1 | | Authors: | Carrasco-Lopez, C., Avalos, J.L. | | Deposition date: | 2024-03-06 | | Release date: | 2025-03-06 |
|
| PDBID: | 8s1d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the influenza A matrix protein 1 peptide 100-114 in complex with HLA-DRB1*04:04 | | Authors: | Sharma, R.K., Dubnovitsky, A., Gerstner, C., Boddul, S., James, T., Turcinov, S., Horuluoglu, B., Andriopoulos, P., Kozhukh, G., Achour, A., Wermeling, F., Kwok, W.W., Ronnblom, L., Klareskog, L., James, E., Padyukov, L., Malmstrom, V. | | Deposition date: | 2024-02-15 | | Release date: | 2025-11-15 |
|
| PDBID: | 8rxm | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Galectin-3 in complex with thiogalactoside derivative | | Authors: | Hakansson, M., Diehl, C., Peterson, K., Zetterberg, F., Nilsson, U. | | Deposition date: | 2024-02-07 |
|
| PDBID: | 8rcx | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of the Mycobacterium tuberculosis regulator VirS (N-terminal fragment 4-208) in complex with the drug candidate alpibectir | | Authors: | Edoo, Z., Frita, R., Grosse, C., Bourotte, M., Moune, M., Antoine, R., Trebosc, V., Schellhorn, B., Dreneau, A., Hofmann, L., Kemmer, C., Lociuro, S., Dale, G.E., Jung, F., Perez-Herran, E., Mendoza, A., Rebollo Lopez, M.J., Ghidelli-Disse, S., Drewes, G., Mathys, V., Soetaert, K., Megalizzi, V., Wintjens, R., Barros Aguirre, D., Remuinan, M.D., Gitzinger, M., Deprez, B., Willand, N., Pieren, M., Baulard, A.R. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8x9z | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | P-hexon capsomer of the VZV C-Capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8r77 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Ficin C crystal form 2 | | Authors: | Loris, R., Baeyens-Volant, D., Azarkan, M., Kerff, F. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8uxa | | Status: | HPUB -- hold until publication | | Title: | Glucose treated mitochondrial ribosome of saccharomyces cerevisiae class I | | Authors: | Yu, Z., Zheng, F., Zhou, C. | | Deposition date: | 2023-11-09 | | Release date: | 2025-11-12 |
|
| PDBID: | 8ux4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Mitochondrial ribosome of saccharomyces cerevisiae class II from YEP with Dextrose culture | | Authors: | Yu, Z., Zheng, F., Zhou, C. | | Deposition date: | 2023-11-08 | | Release date: | 2025-10-31 |
|
| PDBID: | 8sup | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the 48S translation initiation complex assembled on the encephalomyocarditis virus IRES | | Authors: | Bhattacharjee, S., Abaeva, I.S., Brown, Z.P., Arhab, Y., Fallah, H., Jeevan, J.C., Hellen, C.U.T., Frank, J., Pestova, T.V. | | Deposition date: | 2023-05-12 |
|
| PDBID: | 7r2n | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | elongated Cascade complex from type I-A CRISPR-Cas system in an active state | | Authors: | Hu, C., Ni, D., Nam, K.H., Terns, M., Stahlberg, H. | | Deposition date: | 2022-02-04 |
|
| PDBID: | 7su5 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Dihydroneopterin aldolase (DHNA) from Yersinia pestis co-crystallized with 6-biopterin | | Authors: | Bourne, C.R. | | Deposition date: | 2021-11-16 |
|
| PDBID: | 7n9m | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Estrogen Receptor Alpha Ligand Binding Domain in Complex with Aliphatic SERD S-C10(13) | | Authors: | Diennet, M., El Ezzy, M., Thiombane, K., Cotnoir-White, D., Poupart, J., Gao, Z., Mendoza, S.R., Marinier, A., Gleason, J., Mader, S.C., Fanning, S.W. | | Deposition date: | 2021-06-18 |
|
| PDBID: | 7n9n | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Estrogen Receptor Alpha Ligand Binding Domain in Complex with Aliphatic SERD S-C10(14) | | Authors: | Diennet, M., El Ezzy, M., Thiombane, K., Cotnoir-White, D., Poupart, J., Gao, Z., Mendoza, S.R., Marinier, A., Gleason, J., Mader, S.C., Fanning, S.W. | | Deposition date: | 2021-06-18 |
|
| PDBID: | 7n9p | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Estrogen Receptor Alpha Ligand Binding Domain in Complex with ICI164,384 | | Authors: | Diennet, M., El Ezzy, M., Thiombane, K., Cotnoir-White, D., Poupart, J., Gao, Z., Mendoza, S.R., Marinier, A., Gleason, J., Mader, S.C., Fanning, S.W. | | Deposition date: | 2021-06-18 |
|
| PDBID: | 2m95 | | Status: | POLC -- waiting for a policy decision | | Title: | Ferredoxin Competes with Bacterial Frataxin in Binding to the Desulfurase IscS | | Authors: | Konarev, P.V., Iannuzzi, C., Adinolfi, S., Roche, B., Kelly, G., Simon, L., Martin, S.R., Py, B., Barras, F., Svergun, D.I. | | Deposition date: | 2013-06-03 |
|
| PDBID: | 2m4a | | Status: | POLC -- waiting for a policy decision | | Title: | NMR data-driven model of GTPase Rheb-GDP tethered to a lipid-bilayer nanodisc | | Authors: | Mazhab-Jafari, M.T., Stathopulos, P.B., Marshall, C.B., Kobashigawa, Y., Stambolic, V., Kay, L.E., Inagaki, F., Ikura, M. | | Deposition date: | 2013-02-03 |
|
| PDBID: | 2m4b | | Status: | POLC -- waiting for a policy decision | | Title: | NMR data-driven model of GTPase Rheb-GTP tethered to a lipid-bilayer nanodisc | | Authors: | Mazhab-Jafari, M.T., Stathopulos, P.B., Marshall, C.B., Kobashigawa, Y., Stambolic, V., Kay, L.E., Inagaki, F., Ikura, M. | | Deposition date: | 2013-02-03 |
|
| PDBID: | 4ajq | | Status: | POLC -- waiting for a policy decision | | Title: | 3D RNA structure of the major HIV-1 packaging signal region | | Authors: | Stephenson, J.D., Kenyon, J.C., Li, H., Symmons, M., Klenerman, D., Lever, A.M.L. | | Deposition date: | 2012-02-16 |
|
