| PDBID: | 8zdl | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacteriophage Douge genome-released connector (GP5, GP9, GP10, GP12 and GP13) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8zdm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Mycobacteriophage Douge genome-released vertex (GP8) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8zdn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacteriophage Douge genome-released tail tube (GP13) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8zdo | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacteriophage Douge baseplate (GP13, GP17, GP23, GP16, GP18, and GP20) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8zdp | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacteriophage Douge Central fiber (gp20) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8zdq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacteriophage Douge complete baseplate (gp13, gp17, gp23, gp16, gp18 and gp20) | | Authors: | Maharana, J., Wang, C.H., Tsai, L.A., Lowary, T.L., Ho, M.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 9bnb | | Status: | HPUB -- hold until publication | | Title: | Collagen XVIII trimerization domain with introduced inter-chain disulfide bond, G(-1)C-L5C | | Authors: | Young, T., Williams, J.C. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 9bie | | Status: | HPUB -- hold until publication | | Title: | human ZYG11B ElonginB/C complex binding to SARS-CoV2 Orf10 protein | | Authors: | Liu, X., Gross, J.D. | | Deposition date: | 2024-04-23 |
|
| PDBID: | 9bhf | | Status: | HPUB -- hold until publication | | Title: | Structure of apo Aggregatibacter actinomycetemcomitans SiaP protein | | Authors: | King-Hudson, T.-R.J., Davies, J.S., Dobson, R.C.J. | | Deposition date: | 2024-04-20 |
|
| PDBID: | 9bhh | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Chikungunya virus asymmetric unit with Fab IM-CKV063 | | Authors: | Su, G.C., Galaz-Montoya, J.G., Pintilie, G., Jin, J., Chiu, W. | | Deposition date: | 2024-04-20 | | Release date: | 2025-10-19 |
|
| PDBID: | 9bh3 | | Status: | HPUB -- hold until publication | | Title: | Structure of apo Aggregatibacter actinomycetemcomitans SiaP protein | | Authors: | King-Hudson, T.-R.J., Davies, J.S., Dobson, R.C.J. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bf7 | | Status: | HOLD -- hold until a certain date | | Title: | SARS-CoV-2 Papain-like Protease (PLpro) C111S Untagged Crystal Structure | | Authors: | Al-Homoudi, A.I., Brunzelle, J.S., Gavande, N., Kovari, L.C. | | Deposition date: | 2024-04-17 | | Release date: | 2025-10-16 |
|
| PDBID: | 9bep | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_8C, a lambda-carrageenan specific sulfatase, in complex with an oligosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9bes | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_8A, a lambda-carrageenan specific sulfatase, in complex with monosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9beu | | Status: | HPUB -- hold until publication | | Title: | Structure of GH110B in complex with a lambda-carrageenan oligosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9bev | | Status: | HPUB -- hold until publication | | Title: | Structure of GH110A in complex with a lambda-carrageenan oligosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9bey | | Status: | HPUB -- hold until publication | | Title: | Structure of a lambda-carrageenan active GH2 A in complex with inhibitor | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9bef | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_8B, a lambda-carrageenan specific sulfatase, in complex with an oligosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9beh | | Status: | HPUB -- hold until publication | | Title: | Structure of GH110A in complex with galactose-6-sulfate | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bdb | | Status: | HPUB -- hold until publication | | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | | Authors: | Schormann, N., Green, T., Turnbough, C.L. | | Deposition date: | 2024-04-11 | | Release date: | 2025-10-10 | | Sequence: | >Entity 1
MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2
AFDPNLVGPTLPPIPPFTL
|
|
| PDBID: | 9bda | | Status: | HPUB -- hold until publication | | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | | Authors: | Schormann, N., Green, T., Turnbough, C.L. | | Deposition date: | 2024-04-11 | | Release date: | 2025-10-10 | | Sequence: | >Entity 1
MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2
AFDPNLVGPTLPPIPPFTL
|
|
| PDBID: | 9bcw | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | PawS-Derived Peptides with two disulfide bonds can adopt different structural folds | | Authors: | Hajiaghaalipour, F., Wong, W., Payne, C.D., Fisher, M.F., Clark, R.J., Mylne, J.S., Rosengren, K.J. | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9exn | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | The vaccinia minimal RNA polymerase cryo EM structure at 1.9A resolution | | Authors: | Grimm, C., Jungwirth, S., Fischer, U. | | Deposition date: | 2024-04-08 |
|
| PDBID: | 9bbn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Chikungunya virus asymmetric unit with Fab C9 | | Authors: | Su, G.C., Galaz-Montoya, J.G., Pintilie, G., Jin, J., Chiu, W. | | Deposition date: | 2024-04-06 | | Release date: | 2025-10-05 |
|
| PDBID: | 9bb9 | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_8A, a lambda-carrageenan specific sulfatase | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-05 |
|
