PDBID: | 9ps5 | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-24 |
|
PDBID: | 9ps6 | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-24 |
|
PDBID: | 9ps3 | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-24 |
|
PDBID: | 9ps2 | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-24 |
|
PDBID: | 9ps1 | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-24 |
|
PDBID: | 9pre | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of oxidised E.coli DsbA in complex with propiolic acid | Authors: | Balaji, G.R., Ilyichova, O.V., Tasdan, Y., Akhtar, N., Scanlon, M.J. | Deposition date: | 2025-07-24 | Release date: | 2026-07-24 |
|
PDBID: | 9prf | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of E.coli DsbA in-complex with analogue 6 | Authors: | Balaji, G.R., Ilyichova, O.V., Tasdan, Y., Akhtar, N., Scanlon, M.J. | Deposition date: | 2025-07-24 | Release date: | 2026-07-24 |
|
PDBID: | 9prg | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of E.coli DsbA in-complex with analogue 7 | Authors: | Balaji, G.R., Ilyichova, O.V., Tasdan, Y., Akhtar, N., Scanlon, M.J. | Deposition date: | 2025-07-24 | Release date: | 2026-07-24 |
|
PDBID: | 9pry | Status: | AUTH -- processed, waiting for author review and approval | Title: | HIV-1 CA hexamer from purified viral cores, C1 symmetry | Authors: | Barros dos Santos, N.F., Ganser-Pornillos, B.K., Pornillos, O. | Deposition date: | 2025-07-24 |
|
PDBID: | 9prh | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of E.coli DsbA in-complex with analogue 8 | Authors: | Balaji, G.R., Ilyichova, O.V., Tasdan, Y., Akhtar, N., Scanlon, M.J. | Deposition date: | 2025-07-24 | Release date: | 2026-07-24 |
|
PDBID: | 9pri | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of oxidised E.coli DsbA in-complex with analogue 9 | Authors: | Balaji, G.R., Ilyichova, O.V., Tasdan, Y., Akhtar, N., Scanlon, M.J. | Deposition date: | 2025-07-24 | Release date: | 2026-07-24 |
|
PDBID: | 9prj | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of E.coli DsbA in-complex with analogue 13 | Authors: | Balaji, G.R., Ilyichova, O.V., Tasdan, Y., Akhtar, N., Scanlon, M.J. | Deposition date: | 2025-07-24 | Release date: | 2026-07-24 |
|
PDBID: | 9prk | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of E.coli DsbA in complex with analogue 17 | Authors: | Balaji, G., Tasdan, Y., Akhtar, N., Scanlon, M.J. | Deposition date: | 2025-07-24 | Release date: | 2026-07-24 |
|
PDBID: | 9prl | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of E.coli DsbA in complex with analogue 18 | Authors: | Balaji, G.R., Tasdan, Y., Akhtar, N., Scanlon, M.J. | Deposition date: | 2025-07-24 | Release date: | 2026-07-24 |
|
PDBID: | 9prm | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of E.coli DsbA in complex with analogue 20 | Authors: | Balaji, G.R., Tasdan, Y., Akhtar, N., Scanlon, M.J. | Deposition date: | 2025-07-24 | Release date: | 2026-07-24 |
|
PDBID: | 9prp | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-24 |
|
PDBID: | 9pru | Status: | HOLD -- hold until a certain date | Deposition date: | 2025-07-24 | Release date: | 2026-01-24 | Sequence: | >Entity 1 AIVLTQSPASLAVSLGQRATISCKASQSVDFDGDSFMNWYQQKPGQPPKLLIYTTSNLESGIPARFSASGSGTDFTLNIHPVEEEDTATYYCQQSNEDPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>Entity 2 QVTLKESGPGILQPSQTLSLTCSFSGFSLRTSGMGVGWIRQPSGKGLEWLAHIWWDDDKRYNPALKSRLTISKDTSSNQVFLKIASVDTADTATYYCAQINPAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCG
>Entity 3 RTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDQSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTQLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVQITITQG
|
|
PDBID: | 9prr | Status: | AUTH -- processed, waiting for author review and approval | Title: | X-ray crystal structure of Streptomyces cacaoi PolF in complex with iron and L-isoleucine | Authors: | Blancas Cortez, J.J., Boal, A.K. | Deposition date: | 2025-07-24 |
|
PDBID: | 9prv | Status: | HPUB -- hold until publication | Title: | Crystal structure of thermostable variant of phosphite dehydrogenase from Pseudomonas stutzeri | Authors: | Chang, C., Joachimiak, A., Michalska, K., Osipiuk, J., Endres, M., Ping, Y. | Deposition date: | 2025-07-24 |
|
PDBID: | 9prq | Status: | PROC -- to be processed | Title: | In situ structure of human mitoribosome in the A/T-P state from TACO1-knockout cells | Authors: | Wang, S., Xiong, Y., Zhang, Y. | Deposition date: | 2025-07-24 |
|
PDBID: | 9pro | Status: | HOLD -- hold until a certain date | Deposition date: | 2025-07-24 | Release date: | 2026-07-24 |
|
PDBID: | 9prt | Status: | HOLD -- hold until a certain date | Deposition date: | 2025-07-24 | Release date: | 2026-07-24 |
|
PDBID: | 9prs | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2025-07-24 |
|
PDBID: | 9prx | Status: | PROC -- to be processed | Title: | In situ structure of the human mitoribosome in the A-P state from TACO1-knockout cells | Authors: | Wang, S., Xiong, Y., Zhang, Y. | Deposition date: | 2025-07-24 | Release date: | 2026-07-24 |
|
PDBID: | 9prw | Status: | HPUB -- hold until publication | Deposition date: | 2025-07-24 |
|