| PDBID: | 9qs4 | | Status: | HPUB -- hold until publication | | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | | Authors: | Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qs9 | | Status: | HPUB -- hold until publication | | Title: | Structure and mechanism of the broad spectrum CRISPR-associated ring nuclease Crn4 | | Authors: | McMahon, S.A., Chi, H., Hoikkala, V., Gloster, T.M., White, M.F. | | Deposition date: | 2025-04-04 | | Sequence: | >Entity 1
MTSATPVTLVNLTPAEVILHLDGGPLRLPGADVVPRLLLSEGRQETLAVYDPERPGEAAVAREVPIAVGATWLGIDPPLPEPRPGTVYVTSRVVAEHFPERTDLVWPDDLIRDADGQVVGARRLGCLPRGDDDGAPGDLDERRRAEGER
>Entity 2
AAAAAA
|
|
| PDBID: | 9ucg | | Status: | HPUB -- hold until publication | | Title: | A Fab structure with a covalent bond | | Authors: | Makabe, K., Nakanishi, T. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9ucm | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human G6P transporter SLC37A2 in the apo state with a symmetric ER luminal-open conformation. | | Authors: | Sun, L., Liu, X., Lai, Q. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9o2v | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM Structure of VgrG4 from Hypervirulent Klebsiella pneumoniae kp52.145 | | Authors: | Noske, G.D., Dominguez-Antty, J.H., Paula, T.G., Aleixo, M.A.A., Portugal, R.V., Cunha, M.M.L., Amorim, G.C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9o2y | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of WT E.coli ribosome 70S subunit with complexed with mRNA, P-site fMet-NH-tRNAfMet and A-site (R) beta-2-hydroxy-BocLysine acid charged NH-tRNAPyl | | Authors: | Majumdar, C., Cate, J.H.D. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9o2x | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of WT E.coli ribosome 70S subunit with complexed with mRNA, P-site fMet-NH-tRNAfMet and A-site (S)-betahydroxyBocK charged NH-tRNAPyl | | Authors: | Majumdar, C., Kent, A., Hamlish, N., Zhu, C., Cate, J. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9o35 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DoxA in complex with daunorubicin | | Authors: | Newmister, S.A., Harte, R.J., Kim, R.Q., Metsa-Ketela, M., Sherman, D.H. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9uc5 | | Status: | HPUB -- hold until publication | | Title: | Mini-protein binder of N-terminal domain of nucleocapsid protein of SARS-CoV2 | | Authors: | Khakerwala, Z., Kumar, A., Makde, R.D. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o18 | | Status: | HPUB -- hold until publication | | Title: | Fab1504 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o1a | | Status: | HPUB -- hold until publication | | Title: | Pseudomonas aeruginosa ATPase State1 F1Fo focused | | Authors: | Stewart, A.G., Sobti, M. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o1e | | Status: | HPUB -- hold until publication | | Title: | Pseudomonas aeruginosa ATPase State2a Fo focused | | Authors: | Stewart, A.G., Sobti, M. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o1l | | Status: | HPUB -- hold until publication | | Title: | TMEM16F in liposomes in the absence of Ca2+ (expanded state) | | Authors: | Feng, Z., Accardi, A. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o1m | | Status: | HPUB -- hold until publication | | Title: | TMEM16F in liposomes in the presence of Ca2+ (closed state) | | Authors: | Feng, Z., Accardi, A. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o1n | | Status: | HPUB -- hold until publication | | Title: | TMEM16F in liposomes in the presence of Ca2+ (active state) | | Authors: | Feng, Z., Accardi, A. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o1p | | Status: | HPUB -- hold until publication | | Title: | TMEM16F D409G mutant in liposomes in the presence of Ca2+ (closed state) | | Authors: | Feng, Z., Accardi, A. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o1q | | Status: | HPUB -- hold until publication | | Title: | TMEM16F D409G mutant in liposomes in the presence of Ca2+ (active state) | | Authors: | Feng, Z., Accardi, A. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o1i | | Status: | HPUB -- hold until publication | | Title: | TMEM16F in liposomes in the absence of Ca2+ (contracted state) | | Authors: | Feng, Z., Accardi, A. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o1o | | Status: | HPUB -- hold until publication | | Title: | TMEM16F R478E/E604R mutant in liposomes in the presence of Ca2+ | | Authors: | Feng, Z., Accardi, A. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9qqy | | Status: | HPUB -- hold until publication | | Title: | Dye-decolourising peroxidase DtpB XRPP experiment (1000 kGy)-PUMP | | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Maly, M., Owen, R.L. | | Deposition date: | 2025-04-02 |
|
| PDBID: | 9qqw | | Status: | HPUB -- hold until publication | | Title: | LvrB - active conformation | | Authors: | Agustoni, E., Mechaly, A., Rizza, J.D., Beriashvili, D., Pluhackova, K., Isaikina, P., Trajtenberg, F., Muntener, T., Wunder, E., Ko, A., Schirmer, T., Buschiazzo, A., Hiller, S. | | Deposition date: | 2025-04-02 |
|
| PDBID: | 9qqu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an engineered TPR domain in complex with the HSP90 peptide MEEVD | | Authors: | Pinotis, N., Bell, R., Williams, M.A. | | Deposition date: | 2025-04-02 |
|
| PDBID: | 9qr2 | | Status: | HPUB -- hold until publication | | Title: | LvrB inactive | | Authors: | Agustino, E., Buschiazzo, A., Hiller, S., Beriashvili, D. | | Deposition date: | 2025-04-02 |
|
| PDBID: | 9ub0 | | Status: | HOLD -- hold until a certain date | | Title: | effector of a plant pathogen | | Authors: | Ohki, S., Mori, M. | | Deposition date: | 2025-04-02 | | Release date: | 2026-04-02 |
|
| PDBID: | 9qql | | Status: | HPUB -- hold until publication | | Title: | Mouse RPS15 P131 Mutant Ribosome POST translocation state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-04-01 |
|
