| PDBID: | 9qtb | | Status: | HPUB -- hold until publication | | Title: | Apo form of the L protein from Rift Valley Fever Virus | | Authors: | Kral, M., Das, A.R., Kotacka, T., Blahosova, A., Hodek, J., Konvalinka, J., Demo, G., Kozisek, M. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cytoplasmic 60S maturation intermediate (State D1) | | Authors: | Kargas, V., Warren, A.J. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qt7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of affitin C10 fused to a coiled-coil domain in complex with a quinoline oligoamide foldamer | | Authors: | Morozov, V., Wang, L., Kwon, S., Douat, C., Huc, I. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9uef | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of AvmO1 mutant - Y282R+V352L and Alchivemycin A | | Authors: | Guo, N., Dong, H., Han, Y., Yang, J., Lei, X. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9ue8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MPXV A35R in complex with a neutralizing antibody BA345 | | Authors: | Sun, D., Zhang, N., Guo, Y. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o4t | | Status: | HPUB -- hold until publication | | Title: | RT XFEL structure of Soybean Lipoxygenase-1 in large unit-cell | | Authors: | Wolff, A.M., Thompson, M.C. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o47 | | Status: | HPUB -- hold until publication | | Title: | RNA dodecamer containing a serinol nucleic acid. | | Authors: | Harp, J.M., Egli, M.E. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9udw | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human G6P transporter SLC37A2 in the G6P bound state with a symmetric cytosolic-open conformation. | | Authors: | Sun, L., Liu, X., Lai, Q. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udx | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human G6P transporter SLC37A2 in the presence of G6P with a symmetric ER luminal-open conformation. | | Authors: | Sun, L., Liu, X., Lai, Q. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MPXV A35R in complex with a neutralizing antibody MA42 | | Authors: | Sun, D., Zhang, N., Guo, Y. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9ue0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MPXV A35R in complex with a neutralizing antibody MA49 | | Authors: | Sun, D., Zhang, N., Guo, Y. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3c | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a fully closed state | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3a | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a semi-closed state | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3r | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of I64A Variant of D-Dopachrome Tautomerase (D-DT) | | Authors: | Pilien, A.V.R., Argueta, C., Parkins, A., Pantouris, G. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSAGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
|
|
| PDBID: | 9o3d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of broadly neutralizing antibody HEPC108 in complex with Hepatitis C virus envelope glycoprotein E2 ectodomain | | Authors: | Flyak, A.I., Wilcox, X.E. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsn | | Status: | HPUB -- hold until publication | | Title: | Tetrapodal ancestor of L-amino acid oxidases co-crystallized with indole-3-acetic acid | | Authors: | Massari, M., Mattevi, A. | | Deposition date: | 2025-04-06 |
|
| PDBID: | 9qso | | Status: | HPUB -- hold until publication | | Title: | Tetrapodal ancestor of L-amino acid oxidases co-crystallised with indole-3-pyruvate | | Authors: | Massari, M., Mattevi, A. | | Deposition date: | 2025-04-06 |
|
| PDBID: | 9qsm | | Status: | HPUB -- hold until publication | | Title: | small molecule inhibitor in complex with PD-L1 | | Authors: | Muszak, D., Kocik-Krol, J., Zaber, J., Kruc, O., Palej, U., Fijolkowska, K., Maslanka, A., Magiera-Mularz, K., Plewka, J., Stec, M., Siedlar, M., Musielak, B., Kitel, R., Skalniak, L., Surmiak, E. | | Deposition date: | 2025-04-05 |
|
| PDBID: | 9qsj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of SKM-70S ribosomal stalled complex in the A-tRNA positioned (Body open) state. | | Authors: | Morici, M., Corazza, M., Safdari, H.A., Wilson, D.N. | | Deposition date: | 2025-04-05 |
|
| PDBID: | 9qrr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | | Authors: | Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qsa | | Status: | HPUB -- hold until publication | | Title: | Mouse Ribosome rotated-1 PRE state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qrq | | Status: | HPUB -- hold until publication | | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | | Authors: | Krummhaar, M., Langhans, A., Singh, M., Seeberger, P.H., Koksch, B., Roth, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qrt | | Status: | HPUB -- hold until publication | | Title: | FSP1 (tetrapod ancestor; L323A mutant) bound to FAD and NAD+ and compound 2 | | Authors: | Cecchini, D., Mattevi, A. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qs1 | | Status: | HPUB -- hold until publication | | Title: | Tetrapodal ancestor of L-amino acid oxidases | | Authors: | Massari, M., Mattevi, A. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qsb | | Status: | HPUB -- hold until publication | | Title: | The solution structure of the cyanobacterial calcium binding protein CSE at 293 K | | Authors: | Kleusberg, F., Scholl, J., Selim, K.A., Coles, M. | | Deposition date: | 2025-04-04 | | Sequence: | >Entity 1
GSSHHHHHHSSGLVPRGSHMATEQELQSLFNTLDRDQDGKISINELFLSPGLSAVISSETNTNSPQELLVQYDSDQDGSITFEELKKAVKKASNLT
|
|
