| PDBID: | 9sry | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of inhibitor bound Helicobacter pylori Urease | | Authors: | Chen, X., Rodriguez, J., Luecke, H. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9srz | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ss7 | | Status: | HPUB -- hold until publication | | Title: | Human angiotensin 1-converting enzyme C-domain in complex with rentiapril | | Authors: | Gregory, K.S., Acharya, K.R. | | Deposition date: | 2025-09-25 | | Sequence: | >Entity 1
EAEASKFVEEYDRTSQVVWNEYAGANWNYNTNITTETSKILLQKNMQIAQHTLKYGTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPQGSCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWQKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPQMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPN
|
|
| PDBID: | 9ss8 | | Status: | HPUB -- hold until publication | | Title: | Human angiotensin 1-converting enzyme N-domain in complex with rentiapril | | Authors: | Gregory, K.S., Acharya, K.R. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9srt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9sru | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9srw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9srx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ss3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ss9 | | Status: | HPUB -- hold until publication | | Title: | Human angiotensin 1-converting enzyme N-domain in complex with captopril | | Authors: | Gregory, K.S., Acharya, K.R. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ssa | | Status: | HPUB -- hold until publication | | Title: | Human angiotensin 1-converting enzyme C-domain in complex with zofenoprilat | | Authors: | Gregory, K.S., Acharya, K.R. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9srq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9srr | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ssd | | Status: | HPUB -- hold until publication | | Title: | PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Penicillin G - Streptococcus pneumoniae R6 | | Authors: | Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9sse | | Status: | HPUB -- hold until publication | | Title: | PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Ampicillin - Streptococcus pneumoniae R6 | | Authors: | Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ssf | | Status: | HPUB -- hold until publication | | Title: | PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Methicillin - Streptococcus pneumoniae R6 | | Authors: | Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ssb | | Status: | HPUB -- hold until publication | | Title: | Human angiotensin 1-converting enzyme N-domain in complex with zofenoprilat | | Authors: | Gregory, K.S., Acharya, K.R. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ssg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Cephalexin - Streptococcus pneumoniae R6 | | Authors: | Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9srs | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ssh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Ceftriaxone - Streptococcus pneumoniae R6 | | Authors: | Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9srv | | Status: | HPUB -- hold until publication | | Title: | Partial cryo-EM structure of essential Mycoplasma pneumoniae lipoprotein Mpn436 (flexible loops excluded) | | Authors: | Manger, S., Keles, I. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ssi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PENICILLIN-BINDING PROTEIN 1B (PBP-1B) in complex with Cefditoren - Streptococcus pneumoniae R6 | | Authors: | Flanders, P.L., Gillingham, J.R., Contreras-Martel, C., Dessen, A., Carlson, E.E., Ambrose, E.A. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ssc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9ssj | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9wwl | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of transcription activation complex with DevR from Mycobacterium tuberculosis | | Authors: | Lin, W., Shi, J. | | Deposition date: | 2025-09-24 |
|
