| PDBID: | 9ssy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-26 |
|
| PDBID: | 9ssz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-26 |
|
| PDBID: | 9st0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Pol2 catalytic domain bound to DNA and PCNA (ajar conformation) | | Authors: | Roske, J.J., Jones, M.L., Yeeles, J.T.P. | | Deposition date: | 2025-09-26 |
|
| PDBID: | 9st1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-26 |
|
| PDBID: | 9ssl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-26 |
|
| PDBID: | 9sta | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of native quinol dependent Nitric Oxide Reductase with HQE at pH 6.5 | | Authors: | Khaja, F., Antonyuk, S.V., Muench, S.P., Hasnain, S.S. | | Deposition date: | 2025-09-26 |
|
| PDBID: | 9st5 | | Status: | HPUB -- hold until publication | | Title: | BstEII apo | | Authors: | Zhang, J.H., Rety, S., Xi, X.G. | | Deposition date: | 2025-09-26 |
|
| PDBID: | 9st9 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of native quinol dependent Nitric Oxide Reductase at pH 6.5 | | Authors: | Khaja, F., Antonyuk, S.V., Muench, S.P., Hasnain, S.S. | | Deposition date: | 2025-09-26 |
|
| PDBID: | 9st7 | | Status: | HPUB -- hold until publication | | Title: | BstEII in complex with dsDNA substrate | | Authors: | Zhang, J.H., Rety, S., Xi, X.G. | | Deposition date: | 2025-09-26 |
|
| PDBID: | 9wxm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9wxe | | Status: | HOLD -- hold until a certain date | | Title: | X-ray Crystal Structure of Pseudoazurin Met16Ala variant | | Authors: | Sugai, A., Yamaguchi, T. | | Deposition date: | 2025-09-25 | | Release date: | 2026-09-25 | | Sequence: | >Entity 1
ADFEVHMLNKGKDGAAVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN
|
|
| PDBID: | 9wxt | | Status: | PROC -- to be processed | | Title: | Cryo-EM structure of Fks1 in open state | | Authors: | You, Z.L., Bai, L. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9wxc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9wxf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | cryo-electron microscopy structure of Dandelion | | Authors: | Yu, Y., Chen, Q., Tang, Y. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9wxk | | Status: | HPUB -- hold until publication | | Title: | Linear fragment of lycosin9I with anti-MRSA activity | | Authors: | Mironov, P.A., Dubovskii, P.V., Shenkarev, Z.O. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9wx9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9wxn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9wxl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9wxd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of of BetTC cage | | Authors: | Shi, D.J., Cheng, X.Q., Jiang, W.X., Xing, Q. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9wxp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9wxq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9wxo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | MSL3 bound to the H3K36me3 nucleosome | | Authors: | Tang, F.Y., Zhou, Z. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9wxr | | Status: | HPUB -- hold until publication | | Title: | sensory rhodopsin I with its cognate transducer HtrI | | Authors: | Lim, G.Z., Lin, Y.E., Wu, Y.M., Chen, P.C., Fu, H.Y., Yang, C.S. | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9wxh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-25 |
|
| PDBID: | 9wxi | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-25 |
|
