| PDBID: | 9i66 | | Status: | HPUB -- hold until publication | | Title: | Downregulated state of the betaine transporter BetP | | Authors: | Heinz, V., Urbansky, K., Fu, L., Madej, M.G., Ziegler, C. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9i5f | | Status: | HPUB -- hold until publication | | Title: | Glyceraldehyde 3-phosphate dehydrogenase A (GAPDHA) NAD holoenzyme, from Helicobacter pylori | | Authors: | Foster, S.P., Moody, P.C.E. | | Deposition date: | 2025-01-28 |
|
| PDBID: | 9n20 | | Status: | HPUB -- hold until publication | | Title: | Structure of C3d Bound to a Fragment of FHR-2 and S. aureus Efb-C | | Authors: | Duan, H., Geisbrecht, B.V. | | Deposition date: | 2025-01-27 |
|
| PDBID: | 9lp2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of de novo designed amantadine induced heterodimer dAID23.4 | | Authors: | Qihan, J., Longxing, C. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9mzv | | Status: | HPUB -- hold until publication | | Title: | anti-IL6 designed Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Frey, N.C., Seeger, F., Dou, Y., Huo, C., Watkins, A.M., Leaver-Fay, A., Hofmann, J.L., Gligorijevic, V., Bonneau, R. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9i3h | | Status: | HPUB -- hold until publication | | Title: | CP of RHDV mutant - N15 | | Authors: | Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J., Caston, J.R. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9i3j | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | CP of empty RHDV Cr | | Authors: | Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J., Caston, J.R. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9mzc | | Status: | HPUB -- hold until publication | | Title: | anti-IL6 designed Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Frey, N.C., Seeger, F., Dou, Y., Huo, C., Watkins, A.M., Leaver-Fay, A., Hofmann, J.L., Gligorijevic, V., Bonneau, R. | | Deposition date: | 2025-01-22 | | Sequence: | >Entity 1 EVQLVESGGGLVQPGRSMKLSCAASGFIFSNYGMAWVRQAPKKGLEWVAYINYDGGTTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCTTGYYYDGSYYYDRFVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD
>Entity 2 DIQMTQSPSFLSASEGERVTLNCRASQNINKYLDWYQQKLGEAPKLLIYNTNNLHTGIPSRFSGSGSGTDYTITISSLQPEDVATYFCLQRNSWYTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
|
|
| PDBID: | 9i38 | | Status: | HPUB -- hold until publication | | Title: | Solution structure of the de novo designed monoheme protein m4D2 with bound iron(III) 2,4-dimethyldeuteroporphyrin IX | | Authors: | Williams, C., Hutchins, G.H., Molinaro, P.M., Berrones-Reyes, J.C., Lichtenstein, B.R., Koder, R.L., Anderson, J.L.R. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9i3d | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase co-crystallised with Fe and ACdV after 10s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9i3a | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase co-crystallised with Fe and ACdV after 6s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9i3e | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | CP of RHDV mutant - 29N | | Authors: | Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9i3b | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase co-crystallised with Fe and ACdV after 8s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9i3c | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase co-crystallised with Fe and ACdV after 10s O2 exposure | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9lo8 | | Status: | HPUB -- hold until publication | | Title: | Twenty-two polymer Msp1 from S.cerevisiae(with a catalytic dead mutation) in complex with an unknown peptide substrate | | Authors: | Chengdong, H., Simin, W., Xuan, C. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9lnt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of de novo designed amantadine induced homotrimer mAIT03 | | Authors: | Qihan, J., Longxing, C. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9lns | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of de novo designed amantadine induced homotrimer dAIT17 | | Authors: | Qihan, J., Longxing, C. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9ln7 | | Status: | HPUB -- hold until publication | | Title: | Alpha-7 nicotinic acetylcholine receptor bound to inhibitory bicyclic peptide KP2007 in a resting state. | | Authors: | Chen, H., Sun, D., Tian, C. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9lmg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of LooH | | Authors: | Zhang, F., Li, Y.C., Zhu, Y., Wang, K., Chang, C.Y., Xu, Z. | | Deposition date: | 2025-01-19 |
|
| PDBID: | 9lmj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of LooH in complex with I-Trp | | Authors: | Zhang, F., Li, Y.C., Zhu, Y., Wang, K., Chang, C.Y., Xu, Z. | | Deposition date: | 2025-01-19 |
|
| PDBID: | 9lmh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of LooH in complex with FAD | | Authors: | Zhang, F., Li, Y.C., Zhu, Y., Wang, K., Chang, C.Y., Xu, Z. | | Deposition date: | 2025-01-19 |
|
| PDBID: | 9lmi | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of LooH in complex with Trp | | Authors: | Zhang, F., Li, Y.C., Zhu, Y., Wang, K., Chang, C.Y., Xu, Z. | | Deposition date: | 2025-01-19 |
|
| PDBID: | 9lm6 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nanobody 1D8 | | Authors: | Wang, Q.Q., Ke, X.L., Li, E.T., Hong, D.X., Li, H.X., Cheng, Z.K., Zhang, J.C., Jin, T.C., Shu, B., Chiu, S. | | Deposition date: | 2025-01-18 | | Release date: | 2026-01-18 |
|
| PDBID: | 9lm5 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of prefusion-stabilized RSV F (DS-Cav1 strain: A2) in complex with nanobody 2A5 | | Authors: | Wang, Q.Q., Ke, X.L., Li, E.T., Hong, D.X., Li, H.X., Cheng, Z.K., Zhang, J.C., Jin, T.C., Shu, B., Chiu, S. | | Deposition date: | 2025-01-18 | | Release date: | 2026-01-18 |
|
| PDBID: | 9lmd | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of the lasso peptide actinosynnelassin | | Authors: | Chunyang, C., Yu, W. | | Deposition date: | 2025-01-18 |
|