| PDBID: | 9ohe | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of apo Toxin B (TcdB) from Clostridioides difficile in the closed CROP state | | Authors: | Miletic, S., Li, Z., Melnyk, R.A. | | Deposition date: | 2025-05-04 |
|
| PDBID: | 9ohf | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of apo Toxin B (TcdB) from Clostridioides difficile in the open CROP state | | Authors: | Miletic, S., Li, Z., Melnyk, R.A. | | Deposition date: | 2025-05-04 |
|
| PDBID: | 9ohb | | Status: | HPUB -- hold until publication | | Title: | Structure of of Undecaprenyl diphosphate synthase (UPPS) from Neisseiria gonorrohea soaked with the fragment PS-5485 | | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Massirer, K.B., Counago, R.M. | | Deposition date: | 2025-05-04 |
|
| PDBID: | 9ohg | | Status: | HPUB -- hold until publication | | Title: | Structure of of Undecaprenyl diphosphate synthase (UPPS) from Neisseiria gonorrohea soaked with the fragment PS-5485 | | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Massirer, K.B., Counago, R.M. | | Deposition date: | 2025-05-04 |
|
| PDBID: | 9ohi | | Status: | HPUB -- hold until publication | | Title: | Structure of of Undecaprenyl diphosphate synthase (UPPS) from Neisseria gonorrohea soaked with the fragment PS-5549 | | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Massirer, K.B., Counago, R.M. | | Deposition date: | 2025-05-04 |
|
| PDBID: | 9oh8 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Apo structure of Undecaprenyl diphosphate synthase (UPPS) from Neisseiria gonorrohea | | Authors: | Santiago, A.S., Llontop, E.E., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Barreiro, G., Massirer, K.B., Counago, R.M. | | Deposition date: | 2025-05-03 | | Release date: | 2026-05-03 |
|
| PDBID: | 9oha | | Status: | HPUB -- hold until publication | | Title: | Structure of of Undecaprenyl diphosphate synthase (UPPS) from Neisseiria gonorrohea co-crystallized with BPH-1100 | | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Massirer, K.B., Counago, R.M. | | Deposition date: | 2025-05-03 |
|
| PDBID: | 9r32 | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF LYSYL-TRNA SYNTHETASE FROM Cryptosporidium parvum COMPLEXED WITH L-LYSINE AND INHIBITOR DDD01887015 | | Authors: | Dawson, A., Baragana, B., Forte, B. | | Deposition date: | 2025-05-02 |
|
| PDBID: | 9ogp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Hepatitis C virus envelope glycoprotein HCV-1 E2ecto from genotype 1a bound to neutralizing antibody K579 and HEPC46 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2025-05-01 |
|
| PDBID: | 9us7 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Hemophore HphA from A. baumannii with Cobalt Phthalocyanine | | Authors: | Nguyen, V.Q., Sugimoto, H., Shoji, O. | | Deposition date: | 2025-05-01 |
|
| PDBID: | 9urz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the Prohibitin complex from Chaetomium thermophilum | | Authors: | Luo, D.Y., Zheng, L.Q., Lu, M.A., Chen, Z.Y., Wang, P.P., Guo, Q., Gao, N. | | Deposition date: | 2025-04-30 |
|
| PDBID: | 9r2c | | Status: | HPUB -- hold until publication | | Title: | CpKRS in complex with inhibitor DDD01038762 | | Authors: | Dawson, A., Baragana, B., Robinson, D.A. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9of4 | | Status: | HPUB -- hold until publication | | Title: | Structure of the Acinetobacter baumannii Response Regulator PmrA Receiver Domain M12I Mutation | | Authors: | Jaimes, F.E., Milton, M.E., Hondros, A.D., Cavanagh, J. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9oex | | Status: | HPUB -- hold until publication | | Title: | K-Ras G12V at 293 K | | Authors: | Xu, M., Deck, S.L., Milano, S.K., Cerione, R.A. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9ofa | | Status: | HPUB -- hold until publication | | Title: | The structure of a Fungal Cyanide Hydratase from Gloeocercospora sorghi | | Authors: | Justo Arevalo, S., Valle-Riestra F, V., Balan, A., Farah, C.S. | | Deposition date: | 2025-04-29 | | Sequence: | >Entity 1
MPINKYKAAVVTSEPVWENLEGGVVKTIEFINEAGKAGCKLIAFPEVWIPGYPYWMWKVNYLQSLPMLKAYRENSIAMDSSEMRRIRAAARDNQIYVSIGVSEIDHATLYLTQVLISPLGDVINHRRKIKPTHVEKLVYGDGSGDSFEPVTQTEIGRLGQLNCWENMNPFLKSLAVARGEQIHVAAWPVYPDLSKQVHPDPATNYADPASDLVTPAYAIETGTWVLAPFQRISVEGLKRHTPPGVEPETDATPYNGHARIFRPDGSLYAKPAVDFDGLMYVDIDLNESHLTKALADFAGHYMRPDLIRLLVDTRRKELVTEVGGGDNGGIQSYSTMARLGLDRPLEEEDYRQGTDAGETEKASSNGHA
|
|
| PDBID: | 9urg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of beta-glucosidase from Bacteroides ovatus bound to beta-D-Glucose | | Authors: | Kumar, A.K., Jamdar, S.N., Sarver, R., Makde, R.D. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9urd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Zinc-binding metallopeptidase (Uniprot: A0AAN3A8D2) from Bacteroides ovatus | | Authors: | Kulkarni, B.S., Kumar, A.K., Jamdar, S.N., Makde, R.D. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9urf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of beta-glucosidase from Bacteroides ovatus | | Authors: | Kumar, A.K., Jamdar, S.N., Sarver, R., Makde, R.D. | | Deposition date: | 2025-04-29 |
|
| PDBID: | 9oef | | Status: | HPUB -- hold until publication | | Title: | Structure of the human astrovirus VA1 capsid spike bound to antibody 7C8 | | Authors: | Ghosh, A., Dzimianski, J.V., Balasco Serrao, V.H., DuBois, R.M. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9oeg | | Status: | HPUB -- hold until publication | | Title: | Structure of the human astrovirus VA1 capsid spike bound to antibody 2A2 | | Authors: | Ghosh, A., Dzimianski, J.V., Balasco Serrao, V.H., DuBois, R.M. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9upi | | Status: | HPUB -- hold until publication | | Title: | Entamoeba histolytica Cyclophilin 18 in complex with Cyclosporin A | | Authors: | Gandhi, S., Vasudevan, D. | | Deposition date: | 2025-04-28 |
|
| PDBID: | 9odt | | Status: | HPUB -- hold until publication | | Title: | The structure of a Bacterial Cyanide Dihydratase from Bacillus safensis PER-URP-08 | | Authors: | Justo Arevalo, S., Valle-Riestra F, V., Balan, A., Chuck, C.S. | | Deposition date: | 2025-04-27 | | Sequence: | >Entity 1
MTSIYPKFRAAAVQAAPVYLNLEATVEKSCELIDEAASNGAKLVAFPEAFLPGYPWFAFIGHPEYTRKFYHELYKNAVEIPSLAIQKISEAAKRNETYVCISCSEKDGGSLYLAQLWFNPNGDLIGKHRKMRASVAERLIWGDGSGSMMPVFQTDIGNLGGLMCWEHQVPLDLMAMNAQNEQVHVASWPGYFDDEISSRYYAIATQTFVLMTSSIYTEEMKEMICLTQEQRDYFETFKSGHTCIYGPDGEPISDMVPAETEGIAYAEIDVERVIDYKYYIDPAGHYSNQSLSMNFNQQPTPVVKQLYHQKNEVFTYEDIQYQHGILEEKV
|
|
| PDBID: | 9od2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of modified Zika virus E protein dimer complexed with a neutralizing antibody SMZAb2 Fab | | Authors: | Galkin, A., Pozharski, E. | | Deposition date: | 2025-04-25 |
|
| PDBID: | 9ocw | | Status: | HPUB -- hold until publication | | Title: | A constitutively active construct of eukaryotic elongation factor 2 kinase | | Authors: | Piserchio, A., Long, K., Isiorho, E.A., Dalby, K., Ghose, R. | | Deposition date: | 2025-04-25 |
|
| PDBID: | 9r0w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glutathione transferase iota 1 from Synechocystis sp. PCC 6803 in complex with FMN | | Authors: | Didierjean, C., Hecker, A., Morette, L. | | Deposition date: | 2025-04-24 |
|
