| PDBID: | 8v42 | | Status: | HPUB -- hold until publication | | Title: | Structure of Human Vaccinia-related Kinase 1 (VRK1) Bound to ACH000400 | | Authors: | Counago, R.M., de Souza, G.P., Azevedo, A., Guimaraes, C., Mascarello, A., Gama, F., Ferreira, M., Arruda, P. | | Deposition date: | 2023-11-28 | | Sequence: | >Entity 1
SMRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAAAAWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKAYAADPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPAANAPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRAAEIEE
|
|
| PDBID: | 8r7z | | Status: | HPUB -- hold until publication | | Title: | transcription factor BARHL2 homodimer with spacing four bp | | Authors: | Morgunova, E., Popov, A., Yin, Y., Taipale, J. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7f | | Status: | HPUB -- hold until publication | | Title: | Transcription factor BARHL2 homodimer with spacing two bp | | Authors: | Morgunova, E., Popov, A., Yin, Y., Taipale, J. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8v2w | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the ancestral triosephosphate isomerase reconstruction of the last opisthokont common ancestor obtained by Bayesian inference | | Authors: | Perez-Nino, J.A., Rodriguez-Romero, A., Guerra, Y., Fernandez-Velasco, D.A. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8v2x | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the reconstruction of the worst case of the ancestral triosephosphate isomerase of the last opisthokont common ancestor obtained by bayesian inference | | Authors: | Perez-Nino, J.A., Rodriguez-Romero, A., Guerra-Borrego, Y., Fernandez-Velasco, D.A. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8r71 | | Status: | HPUB -- hold until publication | | Title: | Polysaccharide lyase BtPL33HA (BT4410) Y291A with HAdp4 collected at 1.22 A | | Authors: | Cartmell, A. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8r72 | | Status: | HPUB -- hold until publication | | Title: | Polysaccharide lyase BtPL33HA (BT4410) Y291A with HA dp4 collected at 1.33 A | | Authors: | Cartmell, A. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8r70 | | Status: | HPUB -- hold until publication | | Title: | Polysaccharide lyase BtPL33HA (BT4410) Y291A with HA dp4 | | Authors: | Cartmell, A. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8r6z | | Status: | HPUB -- hold until publication | | Title: | Polysaccharide lyase BtPL33HA (BT4410) Apo form 2 | | Authors: | Cartmell, A. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8r75 | | Status: | HPUB -- hold until publication | | Title: | Polysaccharide lyase BtPL33HA (BT4410) Apo form 1 | | Authors: | Cartmell, A. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8r73 | | Status: | HPUB -- hold until publication | | Title: | Polysaccharide lyase BtPL33HA (BT4410) Apo form 1 | | Authors: | Cartmell, A. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8v2v | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of recifin A [Y6F] | | Authors: | Payne, C.D., Schroeder, C.I., Rosengren, K.J. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8x6s | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | FMDV (A/TUR/14/98) in complex with M688F | | Authors: | Li, H.Z., Dong, H., Liu, P. | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8x6j | | Status: | HPUB -- hold until publication | | Title: | The X-ray structure of N-terminal catalytic domain of Thermoplasma acidophilum tRNA methyltransferase Trm56 (Ta0931) in complex with S-adenosyl-L-methionine | | Authors: | Fukumoto, S., Hasegawa, T., Ototake, M., Moriguchi, S., Namba, M., Yamagamai, R., Kawamura, T., Hirata, A., Hori, H. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8x66 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of triple mutant X11P(P71T+N13F+Q34L) xylanase from a metagenome derived gene from sugarcane bagasse collection site | | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MAQQCITSSQTGFHGGYFYSFWTDGGGSVSFCLLNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
| PDBID: | 8v1a | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoguanine and ATP in two different conformation: 8OG (syn)-ATP (A site) and 8OG (anti)-ATP (E site) | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8x65 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of X11P(P71T) xylanase from a metagenome derived gene from sugarcane bagasse collection site | | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MAQQCITSSQTGNHGGYFYSFWTDGGGSVSFCLQNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
| PDBID: | 8v17 | | Status: | HPUB -- hold until publication | | Title: | HIV-CA Disulfide linked Hexamer with inhibitor bound - exploration of a benzothiazole | | Authors: | Goldstone, D.C., Walsham, L.J. | | Deposition date: | 2023-11-19 | | Sequence: | >Entity 1
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKAR
|
|
| PDBID: | 8v16 | | Status: | HPUB -- hold until publication | | Title: | Esterase with a monomeric cooperative, hysteresis or allokairy | | Authors: | Guzzo, C.R., Vinces, T.G.C., Visnardi, A.B. | | Deposition date: | 2023-11-19 |
|
| PDBID: | 8x5s | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of shikimate kinase of Mycobacterium tuberculosis complex with shikimate-3-phosphate | | Authors: | Yadav, A.K., Madhuri, M., Saini, C., Inampudi, K.K., Ethayathulla, A.S., Kumar, M. | | Deposition date: | 2023-11-18 | | Release date: | 2024-11-18 |
|
| PDBID: | 8v0a | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the worst case of the reconstruction of the ancestral triosephosphate isomerase of the last opisthokont common ancestor obtained by maximum likelihood with PGH | | Authors: | Perez-Nino, J.A., Rodriguez-Romero, A., Guerra-Borrego, Y., Fernandez-Velasco, D.A. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8r5a | | Status: | HPUB -- hold until publication | | Title: | Structure of the Co(II) triggered TRAP (S33HK35H) protein cage (dextro form) | | Authors: | Biela, A.P., Heddle, J.G. | | Deposition date: | 2023-11-16 |
|
| PDBID: | 8r58 | | Status: | HPUB -- hold until publication | | Title: | The RSK 2 N-terminal kinase domain in complex with BMF (1-19) | | Authors: | Sok, P., Remenyi, A. | | Deposition date: | 2023-11-16 |
|
| PDBID: | 8r5e | | Status: | HPUB -- hold until publication | | Title: | JNK1 covalently bound to RU77 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A. | | Deposition date: | 2023-11-16 |
|
| PDBID: | 8r5f | | Status: | HPUB -- hold until publication | | Title: | ERK2 covalently bound to RU83 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A. | | Deposition date: | 2023-11-16 |
|
