| PDBID: | 9w37 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9w38 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9w3b | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal Structure of Enterovirus A71 3C Protease in Complex with a Broad-spectrum Inhibitor | | Authors: | Liu, L., Yang, X., Chen, Z.F., Zhang, X.L., Liu, H., Bai, F. | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9w34 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9w3h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human dihydroorotate dehydrogenase with HL-011. | | Authors: | Jun, L., Yuanyuan, Z. | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9w3k | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9w3p | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9w3l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9w3o | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal Structure of Enterovirus A71 3C Protease in Complex with a Broad-spectrum Inhibitor | | Authors: | Liu, L., Yang, X., Chen, Z.F., Zhang, X.L., Liu, H., Bai, F. | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9w3i | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9w3r | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9s5j | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9s56 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-07-29 | | Release date: | 2026-07-29 |
|
| PDBID: | 9s57 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-07-29 | | Release date: | 2026-07-29 |
|
| PDBID: | 9s5o | | Status: | HPUB -- hold until publication | | Title: | Time-resolved SFX series of the DtpAa Y389F variant mixed with hydrogen peroxide -time zero | | Authors: | Williams, L.J., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2025-07-29 | | Sequence: | >Entity 1
DPAGADAGSAVPFHGAHQAGIATPVQDRLHFAAFDVTTEDRAAFVALLKEWTAAARRLTAGHAVGEGAYGGLPEAPPDDTGEALGLKPSRLTLTIGFGPSLFTRFGLADLRPEALADLPKFPGDNLDRARSGGDLCVQACADDPQVAVHAIRNLARIGFGKVVVRWSQLGFGKTSSTTPDKQTPRNLLGFKDGTRNIAGTEKDRLDRFVWAAEKDGTPWMTGGSYLVARRIRMHIETWDRASLQEQEDVFGRDKGEGAPVGKAKERDEPFLKAMKPDAHVRLAHPDSNGGATLLRRGYSFTDGTDGLGRLDAGLFFLAYQRDIRTGFVPVQRNLATDALNEFIQHVGSAVFAVPPGVRDADDWWGSTLFGKEA
|
|
| PDBID: | 9s55 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Locked-state RyR1 with ryanodine in the native membrane | | Authors: | Mikirtumov, V. | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9s58 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-07-29 | | Release date: | 2026-07-29 |
|
| PDBID: | 9s53 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Cryo-EM structure of the base of the Saccharomyces cerevisiae KMN junction complex containing the Mis12c(Mtw1c) head 2 domain | | Authors: | Turner, N.N., Barford, D. | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9s54 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Down class, Locked-state RyR1 with ryanodine in the native membrane | | Authors: | Mikirtumov, V. | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9s5n | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Cryo-EM structure of the Saccharomyces cerevisiae KMN junction complex containing the Mis12c(Mtw1c) head 2 domain | | Authors: | Turner, N.N., Barford, D. | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9s5s | | Status: | HPUB -- hold until publication | | Title: | Time-resolved SFX series of the DtpAa Y389F variant mixed with hydrogen peroxide -time 20 min+ | | Authors: | Williams, L.J., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2025-07-29 | | Sequence: | >Entity 1
DPAGADAGSAVPFHGAHQAGIATPVQDRLHFAAFDVTTEDRAAFVALLKEWTAAARRLTAGHAVGEGAYGGLPEAPPDDTGEALGLKPSRLTLTIGFGPSLFTRFGLADLRPEALADLPKFPGDNLDRARSGGDLCVQACADDPQVAVHAIRNLARIGFGKVVVRWSQLGFGKTSSTTPDKQTPRNLLGFKDGTRNIAGTEKDRLDRFVWAAEKDGTPWMTGGSYLVARRIRMHIETWDRASLQEQEDVFGRDKGEGAPVGKAKERDEPFLKAMKPDAHVRLAHPDSNGGATLLRRGYSFTDGTDGLGRLDAGLFFLAYQRDIRTGFVPVQRNLATDALNEFIQHVGSAVFAVPPGVRDADDWWGSTLFGKEA
|
|
| PDBID: | 9s5h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | anammox-specific heterodimeric ketoacyl-ACP synthase (amxFabFhet) from Brocadia fulgida | | Authors: | Granatino, P., Barends, T. | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9s59 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | diFe-Sulerythin_E53D O2-reacted | | Authors: | Jeoung, J.-H., Dobbek, H. | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9s5a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Down class, Apo-state RyR1 in the native membrane solved by StA | | Authors: | Mikirtumov, V. | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9s5g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Temporizin-1 NMR analysis | | Authors: | Falcigno, L., D''Auria, G., Galdiero, S., Falanga, A., Bellavita, R. | | Deposition date: | 2025-07-29 |
|
