| PDBID: | 9je6 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of Ac-G51DA53T low salt a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2024-09-02 |
|
| PDBID: | 9je4 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of Ac-E57A_G51DA53T a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2024-09-02 |
|
| PDBID: | 9je7 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of Ac-E57Q_G51DA53T a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2024-09-02 |
|
| PDBID: | 9je8 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of Ac-G51DA53T 30days a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2024-09-02 |
|
| PDBID: | 9dgn | | Status: | HPUB -- hold until publication | | Title: | DNA Tensegrity Triangle with T Junctions | | Authors: | Koomullam, N., Mao, C. | | Deposition date: | 2024-09-02 |
|
| PDBID: | 9dg2 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | PmHMGR bound to mevalonate, CoA, and NAD, buffer-exchanged to ammonium acetate environment at pH 6.7 | | Authors: | Purohit, V., Steussy, C.N., Schmidt, T., Stauffacher, C.V., Rushton, P. | | Deposition date: | 2024-09-01 |
|
| PDBID: | 9jdk | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of Ac-G51DA53T P6 a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2024-08-31 |
|
| PDBID: | 9jd7 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of Ac-G51DA53T a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2024-08-30 |
|
| PDBID: | 9jd8 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of Ac-G51DA53T P5 a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2024-08-30 |
|
| PDBID: | 9jcn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Zea mays 3-phosphoglycerate dehydrogenase S282L mutant | | Authors: | Li, R., Wang, C. | | Deposition date: | 2024-08-30 |
|
| PDBID: | 9jcm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Zea mays 3-phosphoglycerate dehydrogenase | | Authors: | Li, R., Wang, C. | | Deposition date: | 2024-08-29 |
|
| PDBID: | 9jci | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of human pannexin 3 in nanodisc with C-terminal truncated | | Authors: | Zhang, H., Zhang, H.W., Wang, D. | | Deposition date: | 2024-08-29 |
|
| PDBID: | 9dfa | | Status: | HPUB -- hold until publication | | Title: | Thermococcus gammatolerans DNA Ligase | | Authors: | Rudino-Pinera, E., Quintana-Armas, A.X., Cardona-Felix, C., Flores-Hernandez, E. | | Deposition date: | 2024-08-29 |
|
| PDBID: | 9df9 | | Status: | HPUB -- hold until publication | | Title: | Thermococcus gammatolerans DNA Ligase | | Authors: | Quintana-Armas, A.X., Rudino-Pinera, E., Cardona-Felix, C., Flores-Hernandez, E. | | Deposition date: | 2024-08-29 |
|
| PDBID: | 9dew | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NDM-1 complexed with compound 2 | | Authors: | Jacobs, L.M.C., Chen, Y. | | Deposition date: | 2024-08-29 |
|
| PDBID: | 9dfb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Q108K:K40L:T51V:T53C:R58A:Y19W:Q38L:Q4A:T29L mutant of hCRBPII bound to FR1V in the dark at pH 3.0 | | Authors: | Bingham, C., Geiger, J.H. | | Deposition date: | 2024-08-29 |
|
| PDBID: | 9df8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Q108K:K40L:T51V:T53C:R58A:Y19W:Q38L:Q4A:T29L mutant of hCRBPII bound to FR1V and irradiated with UV light at pH 3.0 | | Authors: | Bingham, C., Geiger, J.H. | | Deposition date: | 2024-08-29 |
|
| PDBID: | 9jc3 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of Ac-G51DA53T P1 a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9jc4 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of Ac-G51DA53T P2 a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9jc5 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of Ac-G51DA53T P3 a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9de0 | | Status: | HOLD -- hold until a certain date | | Title: | The Cryo-EM structure of a complex between GAD65 and b96.11 Fab | | Authors: | Reboul, C.F., Le, S.N., Williams, D.E., Buckle, A.M. | | Deposition date: | 2024-08-28 | | Release date: | 2025-08-28 |
|
| PDBID: | 9de1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Q108K:K40L:T51V:T53C:R58Y:Y19W:Q38L:Q4A:T29L mutant of hCRBPII bound to FR1V in the dark at pH 6.0 | | Authors: | Bingham, C., Geiger, J.H. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9de3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NDM-1 complexed with compound 28 | | Authors: | Jacobs, L.M.C., Chen, Y. | | Deposition date: | 2024-08-28 |
|
| PDBID: | 9glf | | Status: | HOLD -- hold until a certain date | | Title: | Anthraquinone Pigment Production Regulated by Cinnamic Acid | | Authors: | Su, L., Schmalhofer, M., Grammbitter, G.L.C., Paczia, N., Glatter, T., Groll, M., Bode, H.B. | | Deposition date: | 2024-08-27 | | Release date: | 2025-08-27 | | Sequence: | >Entity 1
GSSHHHHHHSGDPASMNNKNKPNRISPELLATCGYFMPRIFFLNSQYAPQVHWGDVVAALSHFPAGNLDLSSEEFWYEWMINWSKVGDSYINIANSAKSEVSHVRALRSAAACYHWAEFMYFSDRSRKIQLREYIRSCFLSSIKYSDLLVDHQYIVVDKFHMPFFLIFPKGYKEEENHPLPCVILSNGLDSMTEIEILSLAEFFLGKNMAVAIFDGPGQGINLGKSPIAIDMELYVSSIVKLLEDDARINSNLLCFLGISFGGYFALRVAQRIGDKFCCIVNLSGGPEIAEFDKLPRRLKEDFQFAFMQDNSHMQSIFDEIKLDISLPCKTKVFTVHGELDDIFQIDKVKKLDQLWGDNHQLLCYESEAHVCLNKINEYMIQVSDWVSEQFWLNGYKKG
|
|
| PDBID: | 9gl5 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of the Thermus thermophilus Q190E mutant of the PilF-GSPIIB domain in the c-di-GMP bound state | | Authors: | Neissner, K., Woehnert, J. | | Deposition date: | 2024-08-27 |
|
