PDBID: | 9ek9 | Status: | HPUB -- hold until publication | Title: | CryoEM structure of the mutant (R140Q) IDH2 homodimer | Authors: | Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M. | Deposition date: | 2024-12-02 |
|
PDBID: | 9eki | Status: | HPUB -- hold until publication | Title: | Crystal structure of the Michaelis complex of the mutant (R140Q) IDH2 homodimer | Authors: | Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M. | Deposition date: | 2024-12-02 |
|
PDBID: | 9ekj | Status: | HPUB -- hold until publication | Title: | Crystal structure of the mutant (R140Q) IDH2 homodimer in complex with clonixin | Authors: | Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M. | Deposition date: | 2024-12-02 |
|
PDBID: | 9ekl | Status: | HPUB -- hold until publication | Title: | Crystal structure of the Michaelis complex of the mutant (R140Q, I319M) IDH2 homodimer | Authors: | Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M. | Deposition date: | 2024-12-02 |
|
PDBID: | 9kt4 | Status: | HPUB -- hold until publication | Title: | complex structure of methyltransferases SMYD2 and inhibitor (003) | Authors: | Lu, J., Sun, Y.L., Lu, W.C., Cao, L.H., Liu, Y.H. | Deposition date: | 2024-12-01 |
|
PDBID: | 9ksd | Status: | AUTH -- processed, waiting for author review and approval | Title: | RfaH-mediated transcription-coupled translation pre-initiation complexes (state 1), with 44-mer mRNA, RfaH, NusA, fMet-tRNA(fMet), IF1, IF2, IF3. | Authors: | Lu, G., Zhang, J., Wang, C., Lin, J. | Deposition date: | 2024-11-29 |
|
PDBID: | 9ksc | Status: | AUTH -- processed, waiting for author review and approval | Title: | RfaH-mediated transcription-coupled translation pre-initiation complexes (state 1), with 44-mer mRNA, RfaH, fMet-tRNA(fMet), IF-1, IF-2, IF-3. | Authors: | Lu, G., Zhang, J., Wang, C., Lin, J. | Deposition date: | 2024-11-29 |
|
PDBID: | 9ksf | Status: | AUTH -- processed, waiting for author review and approval | Title: | RfaH-mediated transcription-coupled translation pre-initiation complexes (state 2), with 56-mer mRNA, RfaH, NusA, fMet-tRNA(fMet), IF-1, IF-2, IF-3. | Authors: | Lu, G., Zhang, J., Wang, C., Lin, J. | Deposition date: | 2024-11-29 |
|
PDBID: | 9kse | Status: | AUTH -- processed, waiting for author review and approval | Title: | RfaH-mediated transcription-coupled translation pre-initiation complexes (state 3), with 32-mer mRNA, RfaH, fMet-tRNA(fMet), IF-1, IF-2, IF-3. | Authors: | Lu, G., Zhang, J., Wang, C., Lin, J. | Deposition date: | 2024-11-29 |
|
PDBID: | 9ejw | Status: | HPUB -- hold until publication | Title: | MCMV immunoevasin m11 binding murine CD44 | Authors: | Deuss, F.A., Rossjohn, J., Sng, X.Y.X., Voigt, V., Schuster, I.S., Fleming, P., Abuwarwar, M., van Dommelen, S., Neate, G., Horsnell, H.L., Golzarroshan, B., Varelias, A., Hill, G.R., Lyman, S.D., Mueller, S.N., Scalzo, A.A., Wikstrom, M.E., Berry, R., Fletcher, A.L., Andoniou, C.E., Degli-Esposti, M.A. | Deposition date: | 2024-11-29 |
|
PDBID: | 9hj9 | Status: | HPUB -- hold until publication | Title: | H1-H3 chimeric hemagglutinin | Authors: | Seraj, N., Harshbarger, W., Mallett, C.P., Vassilev, V. | Deposition date: | 2024-11-28 | Sequence: | >Entity 1 APLQLGNCSVAGWILGNPECELLISRESWSYIVEKPNPENGTCYPGHFADYEELREQLSSVSSFERFEIFPKESSWPNHTQNGGSNSCSHNGESSFYKNLLWLTKSGSLYPNLSKSYANNKEKEVLVLWGVHHPPTIQEQTSLYVKENAYVSVVSSHYSRKFTPEIAKRPKVRDQEGRINYYWTLLEPGDTIIFEANGNLIAPRYAFALSRGSGLVPRGSGHHHHHH
>Entity 2 MGCVAETGQVQLEESGPGLVKPSETLSLTCSVSGVSVTSDIYYWTWIRQPPGKGLEWIGYIFYNGDTNYNPSLKSRVTMSIDTSKNEFSLRLTSVTAADTAVYFCARGTEDLGYCSSGSCPNHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
>Entity 3 MGCVAETGDIVMTQSPSSLSASIGDRVTITCRPSQNIRSFLNWFQHKPGKAPKLLIYAASNLQSGVPSRFSGSGSGTEFTLTIRSLQPEDFATYYCQQSYNTPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
|
|
PDBID: | 9kqy | Status: | HPUB -- hold until publication | Title: | The co-crystal structure of DYRK2 with YK-3-18E | Authors: | Tong, C. | Deposition date: | 2024-11-27 |
|
PDBID: | 9ej7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | CryoEM structure of the mutant (R140Q and I319M) IDH2 homodimer | Authors: | Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M. | Deposition date: | 2024-11-27 |
|
PDBID: | 9hio | Status: | HPUB -- hold until publication | Title: | RKEC1 DNA aptamer bound to dopamine | Authors: | Largy, E., Kaiyum, Y.A., Chao, E.H.P., Vialet, B., Johnson, P.E., Mackereth, C.D. | Deposition date: | 2024-11-26 | Sequence: | >Entity 1 (DT)(DT)(DG)(DA)(DA)(DG)(DG)(DT)(DT)(DC)(DG)(DT)(DT)(DC)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DT)(DG)(DG)(DA)(DG)(DT)
|
|
PDBID: | 9kp8 | Status: | HPUB -- hold until publication | Title: | Crystal structure of FAD-dependent oxidase CpaO | Authors: | Chang, C.Y., Kuo, Y.M., Cheng, T., Liang, C.H., Hsiao, P.Y., Lin, Y.C., Wang, N. | Deposition date: | 2024-11-22 |
|
PDBID: | 9kpc | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of PRRX2 homeobox domain bound to DNA motif | Authors: | Dong, C., Yan, X., Huang, Y., Guo, S. | Deposition date: | 2024-11-22 | Release date: | 2026-05-22 |
|
PDBID: | 9kp1 | Status: | HOLD -- hold until a certain date | Title: | Heterodimer of heptaprenyl diphosphate synthase from B. subtilis | Authors: | Luo, S., Liu, Z.C., Wang, G.G. | Deposition date: | 2024-11-22 | Release date: | 2025-11-22 |
|
PDBID: | 9kp4 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human CASTOR1 in apo form | Authors: | Liu, C., Ding, J., Zhang, T. | Deposition date: | 2024-11-22 | Release date: | 2026-05-22 |
|
PDBID: | 9kpb | Status: | HPUB -- hold until publication | Title: | Crystal structure of human CASTOR2 in apo form | Authors: | Liu, C., Ding, J., Zhang, T. | Deposition date: | 2024-11-22 | Release date: | 2026-05-22 |
|
PDBID: | 9kpg | Status: | HPUB -- hold until publication | Title: | Crystal structure of human CASTOR2-arginine | Authors: | Liu, C., Ding, J., Zhang, T. | Deposition date: | 2024-11-22 | Release date: | 2026-05-22 |
|
PDBID: | 9hi0 | Status: | HOLD -- hold until a certain date | Title: | STRUCTURE OF HUMAN UDP-GALACTOSE 4-EPIMERASE IN COMPLEX WITH COMPOUND WBX04 | Authors: | Mouilleron, S., Schumann, B., Browne, W., Purkiss, A., Weckwerth, T., Ogrodowicz, R., Prema, R., Kunzelmann, S., Roustan, C. | Deposition date: | 2024-11-22 | Release date: | 2025-11-22 |
|
PDBID: | 9hi1 | Status: | HOLD -- hold until a certain date | Title: | STRUCTURE OF HUMAN UDP-GALACTOSE 4-EPIMERASE IN COMPLEX WITH COMPOUND WBX09 | Authors: | Mouilleron, S., Schumann, B., Browne, W., Purkiss, A., Weckwerth, T., Ogrodowicz, R., Prema, R., Kunzelmann, S., Roustan, C. | Deposition date: | 2024-11-22 | Release date: | 2025-11-22 |
|
PDBID: | 9hi2 | Status: | HOLD -- hold until a certain date | Title: | STRUCTURE OF HUMAN UDP-GALACTOSE 4-EPIMERASE IN COMPLEX WITH COVALENT COMPOUND WBC10 | Authors: | Mouilleron, S., Schumann, B., Browne, W., Purkiss, A., Weckwerth, T., Ogrodowicz, R., Prema, R., Kunzelmann, S., Roustan, C. | Deposition date: | 2024-11-22 | Release date: | 2025-11-22 |
|
PDBID: | 9kos | Status: | HPUB -- hold until publication | Title: | Crystal structure of RaTG13 RBD complexed with sheep ACE2 | Authors: | Lan, J., Wang, C.H. | Deposition date: | 2024-11-21 |
|
PDBID: | 9kow | Status: | HPUB -- hold until publication | Title: | Crystal structure of RaTG13 RBD complexed with cattle ACE2 | Authors: | Lan, J., Wang, C.H. | Deposition date: | 2024-11-21 |
|