| PDBID: | 9ycp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HSV Helicase-primase complex bound to IM-250 | | Authors: | Yu, Z., Abarham, J. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9yct | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HSV helicase-primase complex bound to pritelivir | | Authors: | Yu, Z., Abraham, J. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9ycv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HSV Helicase-primase complex bound to amenamevir | | Authors: | Yu, Z., Abraham, J. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9ycx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9ycy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9sq4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9sq6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9sq5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9sqb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | D-stereospecific hydrolase I from Bacillus thuringiensis Berliner 1915 in complex with benzoyl-D-arginine | | Authors: | Simon, A.H., Parthier, C., Bordusa, F., Stubbs, M.T., Schoepfel, M. | | Deposition date: | 2025-09-19 | | Release date: | 2026-09-19 |
|
| PDBID: | 9sq2 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9sq8 | | Status: | HPUB -- hold until publication | | Title: | Structure Of IgGFc-FcRn in complex with VHH 91G06 | | Authors: | Kumar, A., Bertrand, T. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9sq7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Aurora-A bound to DBS2 | | Authors: | Miles, J.A., Bayliss, R.W. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9sqa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Aurora-A bound to DBL4 | | Authors: | Miles, J.A., Bayliss, R.W., Wallis, E.J. | | Deposition date: | 2025-09-19 |
|
| PDBID: | 9sq3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Molybdenum-containing nitrogenase from Methanocaldococcus infernus refined to 1.21 A resolution - crystalline form B. | | Authors: | Maslac, N., Torer, M.R., Bolte, P., Wagner, T. | | Deposition date: | 2025-09-19 | | Sequence: | >Entity 1
MPFVLLDCDKPIPERMKHTYIYDPEEEIIPACNIKTIPGDMTERGCSFAGARGVVGGPVKDVIHMVHGPIGCAFYTWGTRRNLSDFELHRRYCFSTDMQEADIVYGGEKKLEKACIEAAEEFPEAKGIFIYATCPTALIGDNLEAVARKVEEKIKKPVFACNSPGFAGCSQSKGHHIFNTEFYRWLRKAREKYPEKCLKEEEKTPYDIAIVGEYNMDWDLKVIKPLFEKIGCRVVAVFTGNASLDDLFKLPDVKLCVVHCQRSANYIAEMIRDGYNVPRVWVSLFGIEQTAEALRKTAEVLGIDKEKVEQVIKEEVEAIKPQLEFYKSKLEGKRCLVYVGGPRTWHWIRMFKELGVDVVVACCTFAHEDDYEKLNRNLKKAGLKGTLVIDAPNELELEEAIHKYKPDFMLTGLKERYLFRKYGVPTINSHSYEQGPYAGFRGFVNFARDIYKAVCHPIWDILKEGEKKFEEFKKKNN
>Entity 2
MGITYVEKQRAVTINPNKICQPIGAMWATLGVHRAIPFVQGSQGCCTYVRYTFNRHFREPVSIAVASFHEDAAVYGGMKNLVEGIRNLVARYDPDLISVVTTCSSETIGDDIEAFIRAARKKIAKEFGEEKAKLPIIPVHCPSYQASHVKGYDNASKAFLEYLAKKDEEKEPHKINIIPGFGVNPGDILEIKRILDMFGLKEGEDYSILFDISETLYQPLREPIKEIPYYPKGGTKVEEFVDAANAKATFALCKHAGGAGALYLQRKYKVPAYYGLPIGIKNTDDFIINIAKVTGLDIPDKLLDERGKLIDAIVDTVHYTMDKKVGIFGDPDFVIAVSRFCCEIGMKPVVVNTQTPSNTYKKAMEEIANEYNVDIEVQFSDLWDFEKSVKKIGVDLLIGHPRGGVKIAEDLGIGLVRMGFPIYDRVGYFRWPIVGYMGSLRFFDEIVNTILDTQVPWDQKQQ
|
|
| PDBID: | 9wus | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of the Periplasmic Domain of AAA Protease FtsH | | Authors: | Kabasakal, B.V., Goc, G., Yadav, S., Borucu, U., Berger, I., Schaffitzel, C. | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9wuj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Diguanylate cyclase Q15Z91 complex with c-di-GMP and citrate | | Authors: | Han, L., Silvaggi, N.R. | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9wup | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9wuk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9wuc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9wud | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9wue | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of a dNTPase from Vibrio cholerae | | Authors: | Xu, Z.X., Zhang, K. | | Deposition date: | 2025-09-18 | | Release date: | 2026-09-18 |
|
| PDBID: | 9wur | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-09-18 | | Release date: | 2026-09-18 |
|
| PDBID: | 9wub | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Dicovery of SY-589, a Highly Potent and Orally Bioavailable PolQ Helicase Inhibitor, for the Treatment of HR-Deficient Tumors | | Authors: | Hu, H., Daopeng, Y. | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9wu6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-09-18 |
|
| PDBID: | 9wu7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-09-18 |
|
