| PDBID: | 8v50 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a HLA-B*35:01-NP6 with D1 TCR | | Authors: | Littler, D.R., Rossjohn, J., Gras, S. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8v51 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a HLA-B*35:01-NP10 with D1 TCR | | Authors: | Littler, D.R., Rossjohn, J., Gras, S. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8x96 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of enterovirus A71 A-particle in complex with Fab h1A6.2 | | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8x99 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of coxsackievirus A16 A-particle in complex with Fab h1A6.2 | | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8v4z | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a HLA-B*35:01-NP7 with D1 TCR | | Authors: | Littler, D.R., Rossjohn, J. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8r8b | | Status: | HPUB -- hold until publication | | Title: | Wnt binding to COPalpha and COPBeta2 directs secretion on extracellular vesicles | | Authors: | Gurriaran-Rodriguez, U., Datzkiw, D., Radusky, L.G., Fisher, F., Xiao, F., Ming, H., De Repentigny, Y., Kothary, R., Serrano, L., Rojas, A.L., Hierro, A., Rudnicki, M.A. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8r89 | | Status: | HPUB -- hold until publication | | Title: | Structure of peptide CpRE12 bound to DPC micelle | | Authors: | Kornilov, F., Taldaev, A., Bashkirov, P., Bocharov, E. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v4b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR structure of a synthetic analogue of Ramoplanin A2 | | Authors: | Swarbrick, J.D., Marschall, E.A., Cryle, M.J., Tailhades, J. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v42 | | Status: | HPUB -- hold until publication | | Title: | Structure of Human Vaccinia-related Kinase 1 (VRK1) Bound to ACH000400 | | Authors: | Counago, R.M., de Souza, G.P., Azevedo, A., Guimaraes, C., Mascarello, A., Gama, F., Ferreira, M., Arruda, P. | | Deposition date: | 2023-11-28 | | Sequence: | >Entity 1
SMRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAAAAWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKAYAADPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPAANAPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRAAEIEE
|
|
| PDBID: | 8x80 | | Status: | HPUB -- hold until publication | | Title: | Leptin-LepR trimer with a small gap | | Authors: | Xie, Y.F., Gao, F.G. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x81 | | Status: | HPUB -- hold until publication | | Title: | Leptin-LepR trimer with a large gap | | Authors: | Xie, Y.F., Gao, F.G. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7z | | Status: | HPUB -- hold until publication | | Title: | transcription factor BARHL2 homodimer with spacing four bp | | Authors: | Morgunova, E., Popov, A., Yin, Y., Taipale, J. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7f | | Status: | HPUB -- hold until publication | | Title: | Transcription factor BARHL2 homodimer with spacing two bp | | Authors: | Morgunova, E., Popov, A., Yin, Y., Taipale, J. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8v2w | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the ancestral triosephosphate isomerase reconstruction of the last opisthokont common ancestor obtained by Bayesian inference | | Authors: | Perez-Nino, J.A., Rodriguez-Romero, A., Guerra, Y., Fernandez-Velasco, D.A. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8v2x | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the reconstruction of the worst case of the ancestral triosephosphate isomerase of the last opisthokont common ancestor obtained by bayesian inference | | Authors: | Perez-Nino, J.A., Rodriguez-Romero, A., Guerra-Borrego, Y., Fernandez-Velasco, D.A. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8r75 | | Status: | HPUB -- hold until publication | | Title: | Polysaccharide lyase BtPL33HA (BT4410) Apo form 1 | | Authors: | Cartmell, A. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8r73 | | Status: | HPUB -- hold until publication | | Title: | Polysaccharide lyase BtPL33HA (BT4410) Apo form 1 | | Authors: | Cartmell, A. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8r71 | | Status: | HPUB -- hold until publication | | Title: | Polysaccharide lyase BtPL33HA (BT4410) Y291A with HAdp4 collected at 1.22 A | | Authors: | Cartmell, A. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8r72 | | Status: | HPUB -- hold until publication | | Title: | Polysaccharide lyase BtPL33HA (BT4410) Y291A with HA dp4 collected at 1.33 A | | Authors: | Cartmell, A. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8r70 | | Status: | HPUB -- hold until publication | | Title: | Polysaccharide lyase BtPL33HA (BT4410) Y291A with HA dp4 | | Authors: | Cartmell, A. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8r6z | | Status: | HPUB -- hold until publication | | Title: | Polysaccharide lyase BtPL33HA (BT4410) Apo form 2 | | Authors: | Cartmell, A. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8v2v | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of recifin A [Y6F] | | Authors: | Payne, C.D., Schroeder, C.I., Rosengren, K.J. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8x6s | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | FMDV (A/TUR/14/98) in complex with M688F | | Authors: | Li, H.Z., Dong, H., Liu, P. | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8x6j | | Status: | HPUB -- hold until publication | | Title: | The X-ray structure of N-terminal catalytic domain of Thermoplasma acidophilum tRNA methyltransferase Trm56 (Ta0931) in complex with S-adenosyl-L-methionine | | Authors: | Fukumoto, S., Hasegawa, T., Ototake, M., Moriguchi, S., Namba, M., Yamagamai, R., Kawamura, T., Hirata, A., Hori, H. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8x65 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of X11P(P71T) xylanase from a metagenome derived gene from sugarcane bagasse collection site | | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MAQQCITSSQTGNHGGYFYSFWTDGGGSVSFCLQNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
