| PDBID: | 9h4n | | Status: | HPUB -- hold until publication | | Title: | RPL13 (eL13)-mutant 80S ribosome from mouse | | Authors: | Orgebin, E., Astier, A., Rinaldi, D., Baud''huin, M., Plisson-Chastang, C. | | Deposition date: | 2024-10-21 |
|
| PDBID: | 9k3p | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the unliganded human melanocortin receptor 1 (MC1R)-Gs complex | | Authors: | Feng, W.B., Zhou, Q.T., Zheng, C., Yang, D.H., Wang, M.W. | | Deposition date: | 2024-10-19 |
|
| PDBID: | 9k3l | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the unliganded human melanocortin receptor 2 (MC2R)-Gs complex | | Authors: | Feng, W.B., Zhou, Q.T., Zheng, C., Yang, D.H., Wang, M.W. | | Deposition date: | 2024-10-19 |
|
| PDBID: | 9k3k | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the unliganded human melanocortin receptor 4 (MC4R)-Gs complex | | Authors: | Feng, W.B., Zhou, Q.T., Zheng, C., Yang, D.H., Wang, M.W. | | Deposition date: | 2024-10-19 |
|
| PDBID: | 9k3f | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the unliganded human melanocortin receptor 3 (MC3R)-Gs complex | | Authors: | Feng, W.B., Zhou, Q.T., Zheng, C., Yang, D.H., Wang, M.W. | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9k3h | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the unliganded human melanocortin receptor 5 (MC5R)-Gs complex | | Authors: | Feng, W.B., Zhou, Q.T., Zheng, C., Yang, D.H., Wang, M.W. | | Deposition date: | 2024-10-18 |
|
| PDBID: | 9e0s | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a the periplasmic insert from Myxococcus TAtC | | Authors: | Deme, J.C., Bryant, O.J., Berks, B.C., Lea, S.M. | | Deposition date: | 2024-10-18 | | Sequence: | >Entity 1
(MSE)GS(MSE)FTFLLNEEETLALEQRLDTARLRADDALRFLRLGEAEEAGRIAKETSTQLRAEGQGQAPAPEVAPAASVE(MSE)TGRLDGLGRLLDAASVGYGAQSRGVLRQAVEKRVEAVTAYEKKDFAAAAAA(MSE)DGSASLLAGIAPTRTEELAGLWRLEKELATAHAAHEAARWTRP(MSE)LS(MSE)HEQLSENLYFQ
|
|
| PDBID: | 9k2f | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of CyaF/SAH in open conformational state | | Authors: | Chen, R.J., Zhang, L.P., Zhu, Y.G., Zhang, C.S. | | Deposition date: | 2024-10-17 |
|
| PDBID: | 9h3f | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of YhaM | | Authors: | Pane-Farre, J., Madej, M.G., Fu, L., Ziegler, C., Hinrichs, R. | | Deposition date: | 2024-10-16 |
|
| PDBID: | 9jzw | | Status: | HPUB -- hold until publication | | Title: | 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus horikoshii | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9k00 | | Status: | HPUB -- hold until publication | | Title: | 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus abyssi with ADP | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9k01 | | Status: | HPUB -- hold until publication | | Title: | 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus abyssi with residues 51-54 replaced by Neisseria gonorrhoeae residues 49-56 | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9k02 | | Status: | HPUB -- hold until publication | | Title: | 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus abyssi with residues 51-54 replaced by Neisseria gonorrhoeae residues 49-56 and AMP-bound | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9k05 | | Status: | HPUB -- hold until publication | | Title: | 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus horikoshii with 4-Gly insertion at residue 51 | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9k06 | | Status: | HPUB -- hold until publication | | Title: | 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus abyssi with the N-terminal 50 residues deleted | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9k0d | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Amyloid-beta42-4b polymorph 1 | | Authors: | Xia, W.C., Sun, Y.P., Liu, C. | | Deposition date: | 2024-10-15 | | Release date: | 2025-10-15 |
|
| PDBID: | 9k0e | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Amyloid-beta42-4b polymorph 2 | | Authors: | Xia, W.C., Sun, Y.P., Liu, C. | | Deposition date: | 2024-10-15 | | Release date: | 2025-10-15 |
|
| PDBID: | 9k0f | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Amyloid-beta42-4b polymorph 3 | | Authors: | Xia, W.C., Sun, Y.P., Liu, C. | | Deposition date: | 2024-10-15 | | Release date: | 2025-10-15 |
|
| PDBID: | 9jzx | | Status: | HPUB -- hold until publication | | Title: | 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus horikoshii with AMP | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9jzy | | Status: | HPUB -- hold until publication | | Title: | 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus abyssi | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9jzz | | Status: | HPUB -- hold until publication | | Title: | 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus abyssi with AMP | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9k04 | | Status: | HPUB -- hold until publication | | Title: | 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus abyssi with 4-Gly insertion at residue 51 and F54P mutation | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9k03 | | Status: | HPUB -- hold until publication | | Title: | 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus abyssi with 4-Gly insertion at residue 51 and AMP-bound | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9dyv | | Status: | HPUB -- hold until publication | | Title: | Assembly and functional mechanisms of the Hsp70-Hsp40 chaperone machinery | | Authors: | Jiang, Y., Ibrahim, Z., Xia, Y., Kalodimos, C.G. | | Deposition date: | 2024-10-14 |
|
| PDBID: | 9dyu | | Status: | HPUB -- hold until publication | | Title: | Assembly and functional mechanisms of the Hsp70-Hsp40 chaperone machinery | | Authors: | Jiang, Y., Ibrahim, Z., Xia, Y., Kalodimos, C.G. | | Deposition date: | 2024-10-14 |
|
