| PDBID: | 9u52 | | Status: | HPUB -- hold until publication | | Title: | NMR Solution Structures of CX-5461-MYT1L Complex | | Authors: | Li, Y., Cao, C. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nvb | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of human SMYD1 in complex with MYH2 peptide and SAH | | Authors: | Zeng, H., Dong, A., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9ql0 | | Status: | HOLD -- hold until a certain date | | Title: | E. coli IspH crystallized in the presence of adenosine hemisulfate | | Authors: | Bikbaev, K., Dormann, C., Span, I. | | Deposition date: | 2025-03-20 | | Release date: | 2026-03-20 |
|
| PDBID: | 9qkq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of hTEAD4 YAP binding domain (hTEAD4-YBD) in complex with peptide 6 | | Authors: | Pozzi, C. | | Deposition date: | 2025-03-20 | | Sequence: | >Entity 1 GSHMRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
>Entity 2 (ACE)P(6CW)RLRK(NLE)PDSF(ALN)KPP(NH2)
|
|
| PDBID: | 9u4p | | Status: | HOLD -- hold until a certain date | | Title: | Human Keratin 19 tail domain Q387-L400 in solution | | Authors: | Ji, Y., Jeong, M., Kim, J., Lee, C.H. | | Deposition date: | 2025-03-19 | | Release date: | 2026-03-19 | | Sequence: | >Entity 1 QEDHYNNLSASKVL
|
|
| PDBID: | 9u4q | | Status: | HOLD -- hold until a certain date | | Title: | Human Keratin 19 tail domain Q387-L400 in 30% 2,2,2-trifluoroethanol | | Authors: | Ji, Y., Jeong, M., Kim, J., Lee, C.H. | | Deposition date: | 2025-03-19 | | Release date: | 2026-03-19 | | Sequence: | >Entity 1 QEDHYNNLSASKVL
|
|
| PDBID: | 9u4h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the catalytic domain of human PDE3A bound to Ensifentrine | | Authors: | Wu, C.Y., Wang, Y.X. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9u33 | | Status: | HPUB -- hold until publication | | Title: | D14.F25.S02 Fab complexed to DENV2-US/BID/V594/2006 virus - 5f-3f Fab map | | Authors: | Chatterjee, A.C., Mangala Prasad, V. | | Deposition date: | 2025-03-18 |
|
| PDBID: | 9q8c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Protein kinase CK2 catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment F02 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-03-18 |
|
| PDBID: | 9mc2 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of dopaminated Tau fibril | | Authors: | Liu, Z., Li, X., Liu, C. | | Deposition date: | 2025-03-17 | | Release date: | 2026-03-17 |
|
| PDBID: | 9qi9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of styrene monooxygenase RhStyA | | Authors: | Levy, C.W., Ortmayer, M. | | Deposition date: | 2025-03-17 |
|
| PDBID: | 9mb8 | | Status: | HPUB -- hold until publication | | Title: | the complex of D14 and RGSV P3 | | Authors: | Huang, Y.C. | | Deposition date: | 2025-03-15 |
|
| PDBID: | 9ma6 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) Mutant del23T45I in Complex with Nirmatrelvir (P21 space group) | | Authors: | Shin, S.C., Seo, J.J., Yoon, J.M. | | Deposition date: | 2025-03-14 |
|
| PDBID: | 9ma3 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) Mutant del23T45I in Complex with Nirmatrelvir (C2 space group) | | Authors: | Shin, S.C., Seo, J.J., Yoon, J.M. | | Deposition date: | 2025-03-14 |
|
| PDBID: | 9ma7 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of EBV gp350 D123 in complex with neutralizing antibody 1A12 and 1H5 and non-neutralizing antibody 2E9 | | Authors: | Ma, H.Y., Sun, C. | | Deposition date: | 2025-03-14 |
|
| PDBID: | 9nrq | | Status: | HOLD -- hold until a certain date | | Title: | GloR with glyoxal modification | | Authors: | Cuthbert, B.J., de Miranda, R., Martinez, J., Goulding, C.W. | | Deposition date: | 2025-03-14 | | Release date: | 2026-03-14 |
|
| PDBID: | 9ma1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MctB from Mycobacterium tuberculosis at 3.25 Angstroms resolution | | Authors: | Sun, D.M., Chen, L., Wu, M.H., Zang, J.Y., Tian, C.L. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 9m9z | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MctB from Mycobacterium tuberculosis at 2.3 Angstroms resolution | | Authors: | Sun, D.M., Chen, L., Wu, M.H., Zang, J.Y., Tian, C.L. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 9m8w | | Status: | HPUB -- hold until publication | | Title: | NMR structure of ProteinMPNN-desighed ubiquitin variant R4 at pH 3 with 8 M urea | | Authors: | Wu, K.-P., Chen, L.-Y., Chuang, W.-C. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 9m8x | | Status: | HPUB -- hold until publication | | Title: | NMR structure of ProteinMPNN-desighed ubiquitin variant R4 at pH 6.3 with 8 M urea | | Authors: | Wu, K.-P., Chen, L.-Y., Chuang, W.-C. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 9m9g | | Status: | HPUB -- hold until publication | | Title: | NMR structure of ProteinMPNN-designed ubiquitin variant R10 | | Authors: | Wu, K.-P., Chen, L.-Y., Chuang, W.-C. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 9ma0 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of EBV gp350 D123 in complex with neutralizing antibody 4A11 | | Authors: | Ma, H.Y., Sun, C. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 9m9n | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) Mutant del23. | | Authors: | Shin, S.C., Seo, J.J., Yoon, J.M. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 9m9h | | Status: | HPUB -- hold until publication | | Title: | NMR structure of ProteinMPNN-designed ubiquitin variant R4 | | Authors: | Wu, K.-P., Chen, L.-Y., Chuang, W.-C. | | Deposition date: | 2025-03-13 |
|
| PDBID: | 9m9r | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) Mutant del23 in Complex with Nirmatrelvir | | Authors: | Shin, S.C., Seo, J.J., Yoon, J.M. | | Deposition date: | 2025-03-13 |
|